Conserved Protein Domain Family
MVD1

?
COG3407: MVD1 (this model, PSSM-Id:33213 is obsolete and has been replaced by 225941)
Mevalonate pyrophosphate decarboxylase [Lipid metabolism]
Statistics
?
PSSM-Id: 33213
View PSSM: COG3407
Aligned: 17 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 7-Oct-2002
Updated: 7-Oct-2002
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16081942  45 MMKSegyysepskyeaelsdgnITFAYSYPIKAFEKFLGYYDRENRIAFNPSISMRT---DFSFCLAACRYRKNGKTDTV 121 Thermoplasma acidop...
15595031   1 ---------------------mKIKCKVHASLALIKYWGKKDVFLNIPATSSLAVSVd--KFYSISEL----ELSNRDEI 53  Lyme disease spiroc...
19074299   1 MKKPl-----------------SGYGSSHPNIAVIKYWGKADTINNMPSSRSISFPLt--NFLTETVV---EHSLEEDRF 58  Encephalitozoon cun...
15674902   1 MDPN------------------VITVTSYANIAIIKYWGKENQAKMIPSTSSISLTLe--NMFTTTSVSFLPDTATSDQF 60  Streptococcus pyoge...
13541151   1 MSNS------------------SITSVAYPTIGVVLLGGIANEKTRTPLHTSAGIAYt--DSCGSIRTESTIYGDSEMHI 60  Thermoplasma volcanium
13541257  16 MLEDhgylsenndyepnpidgnISISYAYPIKAFEKFLGYYDVENRVAYNPSISMRT---DFSYCIAACRYNKNGNEDTV 92  Thermoplasma volcanium
13541613   9 LLKEkglyrapgkyrkemrygeIHYGSGYPITGLIKFLGYYDESLKIANFPSISLNT---DVSEAYSAFMISKDNGNDTA 85  Thermoplasma volcanium
16081580  33 LLRDrgiyrrpgmhairpayrkIAFGAGYSEIGIIKSLGYYDSTFNILNFPCVSMAA---DFSRAYAALVLTENIGEDTF 109 Thermoplasma acidop...
15789800   1 MRATpph------------rrmKATARAHPIQGLVKYHGMRDESLRMPYHDSISVCT---APSNTTTTVEFDPDRDADQY 65  Halobacterium sp. N...
1706682    1 --MTv----------------yTASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLsqdDLRTLTSA-ATAPEFERDTL 61  baker's yeast
16081942 122 VLDGYADNKY-YKKAKFALDKFRS-EYSIn---------gSFDFYIKRYRRYQKAKGLSESSAVAAAVSRALISnvfGDD 190 Thermoplasma acidop...
15595031  54 ILNSKPVILK--NREKVFFDYARKiLNEP-----------NVRFKIKSKNNFPTAAGLASSSSGFASIAACILK----YF 116 Lyme disease spiroc...
19074299  59 YLNGKMLPIG--EKMGRAVEIFRK-KSGD-----------DRPVCIRSFSNFPHSCGLASSASGLAALVLALND---FYG 121 Encephalitozoon cun...
15674902  61 YINGILQNDEeHTKISAIIDQFR--QPG------------QAFVKMETQNNMPTAAGLSSSSSGLSALVKACDQ---LFD 123 Streptococcus pyoge...
13541151  61 YFNGTESKDE-NRSVKSVLERYRN-ELQS-----------FFGKKDVSYSSLNYGILSGSSDAGAASIGAILSF----ID 123 Thermoplasma volcanium
13541257  93 ILDGVTDEKY-LRKAKFALDYFRK-EFRIk---------gSFDFYIRRYRRYTKAKGLSESSAVAAAVSRALIKnvfGEG 161 Thermoplasma volcanium
13541613  86 VVEGENSPNi-TKKAMTAINVFKN-LYDIk---------gSFHFYLRIKRKYAGAKGLGESAAVAAAASRSLVSalfEKE 154 Thermoplasma volcanium
16081580 110 ILNGRQDEQT-MIMARRVVQLLRSiYSIRg----------SFHVYIKVDNKQGGGCGHWESAAVAAAFARSVARsvfDES 178 Thermoplasma acidop...
15789800  66 VVDGDTVTGHgADRIRSVVDAVRD-RAGf-----------DHRVRLESQNSFPTNIGLGSSSSGFAAAALACVR---AAG 130 Halobacterium sp. N...
1706682   62 WLNGEPHSID-NERTQNCLRDLRQlRKEMeskdaslptlsQWKLHIVSENNFPTAAGLASSAAGFAALVSAIAK---LYQ 137 baker's yeast
16081942 191 AAKDDIFVSRYARLVSGSGTRAAHDGI-SMWLSYP---GMDSRDCVAFKVGKS--NENLNYGVFPKYSDVATDNAHSI-A 263 Thermoplasma acidop...
15595031 117 NKYSCNSASNLARVGSASAARAIYGGFtILKEGSK-------ESFQLRDQSYFndLRIIFAIIDSNEKELSSRAAMNIcK 189 Lyme disease spiroc...
19074299 122 LDMPEEELCIAARIGSGSAGRSISTGI-HLFDGMS-----------VERLPSWkeVRILSIILSGDCKKTGSTEGMIRtK 189 Encephalitozoon cun...
15674902 124 TQLDQKALAQKAKFASGSSSRSFFGPV-AAWDKDS---GAIYKVE----TDLK--MAMIMLVLNAAKKPISSREGMKLcR 193 Streptococcus pyoge...
13541151 124 KKNDIHDIENDIRMISESAGRSLHGGLtITWSDGY----SAYTERVLGPEHFN---NYAIVGFSFDYPRNPSDTIHQN-I 195 Thermoplasma volcanium
13541257 162 PALDDVFVSKYARLVSGSGTRAAHSGI-SIWLSYP---GINLRECAAFRVADD--PHDVYYGIFPKYTDIATDSAHSV-A 234 Thermoplasma volcanium
13541613 155 ALKDSNFISIVARLASGSGSKSVAGPL-SLWLTAP-----AVSHEGSFSLNLRkeIDDIFLCAVPIRDSVSTAEAHNT-V 227 Thermoplasma volcanium
16081580 179 AIEDGPFLSKMARLVSGSGAASTTGPLsVLISWPG------YAHDTSFALGLPmpDTGIALCAVPIAADFHRSNIHEV-A 251 Thermoplasma acidop...
15789800 131 LDLDLPTVSTVARRGSASAARAVTGGFsDLHAGLN------DADCRSERLDAPaeFASDLRIVVGEVPAYKETESAHAeA 204 Halobacterium sp. N...
1706682  138 LPQSTSEISRIARKGSGSACRSLFGGY-VAWEMGKaedGHDSMAVQIADSSDWpqMKACVLVVSDIKKDVSSTQGMQLtV 216 baker's yeast
16081942 264 VNSVFYGTWVSEKFSN---VKRLISDHFDINDLLKIGENDMLRLNSILMSG--GLIIQTPDSLRILKEILKFKS--KNeG 336 Thermoplasma acidop...
15595031 190 RHKFYYDAWIASSKKIf-kDALYFFLKKDFIHFGATIVKSYQNMFALMFASs--IFYFKNSTIDLIRYAADLRN--EGiF 264 Lyme disease spiroc...
19074299 190 ETSNFYQERLARIERKi-kAMVQYISQKDFDGFAHLTMRESNELHAILMETypPIRYIRDDGFKVIEMCHEFNR--DRtR 266 Encephalitozoon cun...
15674902 194 DTSTTFDQWVEQSAIDy-qHMLTYLKTNNFEKVGQLTEANALAMHATTKTAnpPFSYLTKESYQAMEAVKELRQe-GF-A 270 Streptococcus pyoge...
13541151 196 IKSKRYKQRTIDADEHa-hEIKEMARTDDIEGIFEKAEEDTEEYHSILREVg--VLVIRENMQKLIEFIKILRKefWN-- 270 Thermoplasma volcanium
13541257 235 VKSIFYASWLEDKYAN---IKRLIEHNFDIDELLISGENDMLKLNAILFSG--GLIIQTGESLRILRAIQDFK---KNgD 306 Thermoplasma volcanium
13541613 228 IKSPFYQQWSRLQFDA---VYSIISRGGYSAQIIENATTNTYLMHSVLISTg--KLLWNQDTLRAMGIVEDMRRi-GR-L 300 Thermoplasma volcanium
16081580 252 LRSPFYREWATYTRHA---LLDLLNSEFDADTIIRTATNSSLMMHATLMSSr--SILWTEKTIDVVSRILEMRS--GGrA 324 Thermoplasma acidop...
15789800 205 ADSHMFDARLAHVQGQl-aEMRDAVRAGDFQRVFETAEHDSLSLAATTMTGpsGWVYWKPETLSIFETVRELRA--DGvP 281 Halobacterium sp. N...
1706682  217 ATSELFKERIEHVVPKrfeVMRKAIVEKDFATFAKETMMDSNSFHATCLDSfpPIFYMNDTSKRIISWCHTINQfyGEtI 296 baker's yeast
16081942 337 FYFTADTGPSIAIFSFDRSLIDEFRENVNDEYIEGSYDFKGYNNRMRDFIRE 388 Thermoplasma acidophilum
15595031 265 VFETMDAGPQVKFLCLEENLNTILKGLKQNFTG-IDFIVSKVGCDLEWI--- 312 Lyme disease spirochete
19074299 267 VAYTFDAGPNPFLITLEQHLHAVEDFFKAYELVP----CNY----------- 303 Encephalitozoon cuniculi
15674902 271 CYFTMDAGPNVKVLCLEKDLAQLAERLGKNYRI-----IVSKTKDLPDV--- 314 Streptococcus pyogenes M1 GAS
13541151 271 -SYIVTGGSNVYVIVRRDDLERLIHIKNTFGSKPKILNVAGPAWIKKVESD- 320 Thermoplasma volcanium
13541257 307 LFFTADTGPSIMVLSRDKSLIEELRQSVEDPYIEGTYNFNRHTRDLNNFTKE 358 Thermoplasma volcanium
13541613 301 IGFSIDTGPSVLVMADREDLIKEFKERYNGECIDASVPNGAPDIPSSFVESA 352 Thermoplasma volcanium
16081580 325 VGFSIDAGPSVVLMARNAAELDEARRSIDAECVDGSITSGEPSIPPEFLRMA 376 Thermoplasma acidophilum
15789800 282 TYFSTDTGATVYVNTTASHADEVEAAVADCGVDTAVWEVGGPAHELDERDAI 333 Halobacterium sp. NRC-1
1706682  297 VAYTFDAGPNAVLYYLAENESKLFAFIYKLFGSVPGWDKKFTTEQLEAFNHQ 348 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap