Conserved Protein Domain Family
CLN6

?
pfam15156: CLN6 
Ceroid-lipofuscinosis neuronal protein 6
This family of proteins is found in eukaryotes. Proteins in this family are typically between 190 and 310 amino acids in length.
Statistics
?
PSSM-Id: 317560
View PSSM: pfam15156
Aligned: 9 rows
Threshold Bit Score: 420.691
Threshold Setting Gi: 675685713
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
pfam15156 is a member of the superfamily cl21022.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597738052   28 ASKDTDTPVKKPQFHLDLWCFFTIQNWVLDFGRSIIMILFPLQWFPLNKLIVGDYFHIAYNVITPFLLLKLIDRSPKTLP 107
gi 908466872   31 GSTQVEAVRPRPCFHLDLWLSFTFQNWILDVGRPVVMLVLPADWLPLQHPGVADYLHFLYNVTAPLILLKMLERSPRMLP 110
gi 348526588   20 vSKENVPQKKKQRFHFDLWLCLTVQNWILDFGRPIVMIILPLEWFPLNKPSAGDYFHMAYNVITPFLMLKLIERSPRVLS 99
gi 941804186   17 vCKENAPKRKRQPFHFDLWLCLTLQNWILDFGRPIVMIALPLELFPLNKPSVGDYFHMIYNVVAPFLLLKLIERAPRPVP 96
gi 528485402   20 SEKTTAAATPRSQFHTDLWLCFTVQNWILDFGRPIAMIIMPLEWFPLNKPSVGDYFHMAYNVITPFLLLKLIERSPTALP 99
gi 675685713   30 GSVSPEEAAHAAPFHLDLWFYFMLQNWVLDFGRPIAMLVFPLEWFPLNKPSVGDYFHMAYNVITPFLLLKVL--CPMTPT 107
gi 300796576   27 GSAKAEDKDRTAPFHFDLWFYFTLQNWVLDFGRPIAMLVFPIQWFPLNKPSVGDYFHMAYNIITPFLLLKLMERSPRTLP 106
gi 1043429735 204 SSAQPDDGSRTSRFHLDLWFYFTVQNWLLDFGRPIVMIILPLDWFPLNKPSAGDYFHMAYNIITPLLLLKLIERSPKTLP 283
gi 556981162   24 gaADGDAPVKKSHFHLDLWFYFTVQNWVLDFGRPVAMIILPLEWFPLNKPSVGDYFHMAYNVITPFLLLKLIERSPKTLP 103
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597738052  108 VSAVYLCIIAFVMGAS-INLVGDSMNHRLLLSGYQLHLSVRE-------------NPIMKNLNPPS-------------- 159
gi 908466872  111 GLAVRLGIIAVSMGTT-LHLVADSITRRLLLIGYQLHLPVRE-------------NPIMRNLKPSA-------------- 162
gi 348526588  100 RTAVYLCIITFVMGAS-IHLVGDSINHRLMLSGYQLHLSVRE-------------NPIIKDLKPAS-------------- 151
gi 941804186   97 HTAVHLCIITFVMGAS-IHLVGDSINHRLILSGYQLHLSVRE-------------NPIIKDLKPAS-------------- 148
gi 528485402  100 RSAVYLSIITFVMGAS-IHLVGDSINHRLILSGYQLHLSVRE-------------NPIIKDLKPAS-------------- 151
gi 675685713  108 VSCHPHSLHTWQEGDAkPCV---LIQARSCLL-LAGEGCDRAacpgpgaspawacLTEGKARDREQgsggglglgggwse 183
gi 300796576  107 RSIIYVSIITFIMGAS-IHLVGDSVNHRLLFSGYQHHLSVRE-------------NPIIKNLKPET-------------- 158
gi 1043429735 284 NSVIYVSIITFVMGAS-IHLVGDSVNHRLIFSGYQLHLSVRD-------------NPIMQNLTPPT-------------- 335
gi 556981162  104 RAAVYICIITFVMGAS-IHLVGDSVNHRLILSGYQLHLSVRE-------------NPIIKNLKPEA-------------- 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597738052  160 --------------------------LVDSFELLYYYDEHVGRCLWYIPFFLILFLYFSGCFTVLKVEKRMPQSAWLLLA 213
gi 908466872  163 --------------------------LVDFFELLFYYDDTVGHMMWYVPFFLVLVLFFNGCFSRREQEERMPPSAWMLLA 216
gi 348526588  152 --------------------------LIDSFELLYYYDEHLGHLMWYIPFFIILFIYFTGCFSSGEEQKKVPLAGWLLLG 205
gi 941804186  149 --------------------------LIDSFELLYYYDEHLGHLMWYIPFFIIVLIYFSACFSDSDGQEKMPLSGWLLLG 202
gi 528485402  152 --------------------------LIDSFELLYYYDEHLGHSMWYIPFFLIIFLYFTGCFTQVK-DEKMSTSGWLLLG 204
gi 675685713  184 gilgvpaspwtdigipsptlpcpclpQIDSFELLYYYDEYLGHCMWYIPFFLILFMYFSGCFTASKAESLMPGPALLLVA 263
gi 300796576  159 --------------------------LIDSFELLYYYDEYLGHCMWYIPFFLILFMYFSGCFTTSKAESHMPGPALLLVV 212
gi 1043429735 336 --------------------------LVDSFELLYYYDEYLGHSMWYIPFFLILFIYFTGCFTKIRAESRMPLSAWALLA 389
gi 556981162  156 --------------------------LIDSFELLYYYDENLGHSMWYIPFYLIFFLYFTGCFTPIKEDNKMPLSAWLLLG 209
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597738052  214 PSSLYYWYLVTERQIFILFIFTFFAMTATVMHQKRKGLVPDCNGLFLLYSFSIVLILLTVWVSCLWNDKILRKKYPGVIY 293
gi 908466872  217 PNAAYYWYLITEGQTFILFTFTFFAMTTTVMHQRRRGLFLNSDGLFMFYSFSAALVLVAIWVACLWNDSILRTKVPGLIY 296
gi 348526588  206 PSALYYWYLVTEGQITELFLLTFVAMVAMVIFQHHKGLGPDSNGLFLFYSFSVTVLLVALWVAYLWNDPVLRNKYPGLIY 285
gi 941804186  203 ASSLYYWYLATEGQITGLFLLTFLAMFTVMIFQKRKGLAPDSNGSFLFYSFSITLLLVSLWVAYLWDDPVLRNKYPGLFY 282
gi 528485402  205 PSAVYYWYLITEGQIFVLYVFTFFAMVATVMRQRRMGFVLDSNGRFLFYNFIITLGLVLVWVAYLWNDKVLRKKYPGIIY 284
gi 675685713  264 PSGLYYWYLVTEGQIFILFIFTFFAMLALVLHQKRKGLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIY 343
gi 300796576  213 PSGIYYWYLVTEGQIFILFIFTFFAMLALVLHQKRRRLLLDSNGLFLFCSFALTLLLVALWVAWLWNDPVLRKKYPGVIY 292
gi 1043429735 390 PSSLYYWYLVTEGQIFIIFIFTFFAMLAIIMHQRRKGLHLDSNGLFLLFSFSATLIFIAAWIVWLWNDQILRKKYPGVIY 469
gi 556981162  210 PSGLYYWYLVTEGQIFILYIFTFFAMMAIVMHQKRKGLVLDSNGLFLFYSFSITLALIAVWVVWLWNDKILRKKYPGVMY 289
                         330
                  ....*....|....
gi 597738052  294 IPEPWAVYTLHIRD 307
gi 908466872  297 IPQPCTVYTLHLHQ 310
gi 348526588  286 VPEPWSYYTLHIKK 299
gi 941804186  283 VPEPWSYYTLHIRK 296
gi 528485402  285 VPEPWSFYTLHIKG 298
gi 675685713  344 VPEPWAFYTLHVSS 357
gi 300796576  293 VPEPWAFYTLHVSN 306
gi 1043429735 470 IPEPWAFYTLHVNN 483
gi 556981162  290 VPEPWAFYSLHIKS 303
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap