Conserved Protein Domain Family
YrvL

?
pfam14184: YrvL 
Regulatory protein YrvL
YrvL prevents expression and activity of the YrvI sigma factor. It may function as an anti-sigma factor.
Statistics
?
PSSM-Id: 316685
View PSSM: pfam14184
Aligned: 16 rows
Threshold Bit Score: 71.119
Threshold Setting Gi: 81435404
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam14184 is the only member of the superfamily cl16690
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123363626  20 LFFAVFFGITFCIFTVIGIGFLSFLGFEYKSLGAVLIFFLIYFCITTPIDFLCtTILDIF--Ryvnkl--pysiYKLCEF 95
gi 81385943   17 LLILTVFTLFFGSYYFGVAGFFAIFGVTYESPWSLFWYILLSFGLGALFEIPEkILSFMI--G-----------HKAATF 83
gi 33301957   15 IKYLLAAAAVVLTYFAVIYILFSLAGTSYRSAAHVLLFAVVFLVLGLCFEPFErLMIHSF--Tffkt---gkrlFILLAG 89
gi 81366499   19 VISAAVLAFIFGIYYLGMAGLFQLLGIGYDSVQALALFVLLFLLLGIFVELFVkVFNTLL--Lpava---srllQKILEF 93
gi 41688768   27 FIAAIALAVIFGGFFFGMKGLFSILGITYASNQTLALFILACFAVGLIIDPLTkIISIILaksl------slkkTALFAF 100
gi 81582943   20 GFVILFLIIVFAFIFFVYVGIFHITGIGYSSRTALLLFFLLITFLD-GITFFFfIFFKVI--LypmtknmpnwlSITLFA 96
gi 81435404   20 SIIALFLIIVFTFIFFVYVGIFQITGIAYSSRTALLLFFLLITFLD-GITLFIfSFFKAL--LypltqnmsnwiSLTLFS 96
gi 378572181  30 LFLVFVLIFVLAAVFFLFTGTFHLLGIEYDSWRSVFVFIGAGFVADLALGFLL-LFPKVLctLyfars--prwqLFLFLL 106
gi 504457962  23 FLLLLGITIIFGVFFFGMVGLFQLMGVSYESVSSLILFGVLIFILGLLFEAAAkIVKMIS--Lyskp---spsvFLIWRI 97
gi 447210700  20 SFVVFILITFFTFIFFVYVGIFQITGIEYSSRTAILLFFLLILLLD-GITYFIfIFFKSL--LqpmmtsmpnwlSIALLS 96
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 123363626  96 IIDFILTFLAMNIIDTFMDSVTIPLSTEILFALLSYLLSECMDFF 140
gi 81385943   84 MIECFFTWLAIHLADELMDSITIPLDVEIIACLFLFVIHLAFEDN 128
gi 33301957   90 IVQLLFLWMTAHTTDQLISDIWLSTTEEMIVAAVFLILDKCNSAl 134
gi 81366499   94 CIRYTFTLPVVFLLNHYMSTIHIKLMSQAALAAFVVVIEMLIDNE 138
gi 41688768  101 ILYFISNLITICFADYFMQSIYIPDVLLVVISAFMAIIELAFDNQ 145
gi 81582943   97 IIEITLDWFVIHIADDWIESVQLSNLAELCIVLFLFLLSKLLSDK 141
gi 81435404   97 FIEITLDWFVIHTADDWIESVQMSNLTELCVVLFFFLLNKLLSDK 141
gi 378572181 107 LLQFTFDLISVHYIDEWMDGVSIGSGAEAAFVLIMLALDKLLPDR 151
gi 504457962  98 FIDLLFTWLTIYTVDELVSQVTMVLWSEWFFTFLLVTADYVFDEK 142
gi 447210700  97 IIEITLDWFVIHTADDWIESVQMSNIAELCVALFLYTLNILFSDK 141
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap