4BKW


Conserved Protein Domain Family
DUF3480

?
pfam11979: DUF3480 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF3480)
This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 350 to 362 amino acids in length. This domain is found associated with pfam01363.
Statistics
?
PSSM-Id: 314798
View PSSM: pfam11979
Aligned: 28 rows
Threshold Bit Score: 388.516
Threshold Setting Gi: 308502876
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4BKW_A         154 LPTPPYLFGILIQKWETPWAKVFPIRLMLRLGAEYRLYPCPLFSVRFRKPLFGETGHTIMNLLADFRNYQYTLPVVQGLV 233
gi 749785007  1088 LPPAPFLVGLLIHRWETPWAKVFPLRLLLRLGAEYRYYPCPLVSVRFRDALYFEIGHTVMKVLADFRNFGYTLPGVKGLT 1167
gi 242016103   389 LPPPPFLVGILIHKSEIPWARVFPLRLMLRLGAEFRYYPCPLVSVRFREPVYYEVGHTIIKLLADFQNLKYTIPSVRGLR 468
gi 675855778  1378 LPPPPYLFAVYVHSNELMWAHAFPLRLVFRLGAEFRYYPCPLVSRMNRPAVYGEVGHTIMNLLVDFRNFQYTMNKIDDLV 1457
gi 641657215   738 LPSPPYLFALLVHQYETPWAKMFPIRLMLRLGAEYRYYPCMLVSIRNRPSLYTEIGQTVIKLLVDFRQYSYGLPTVKGCY 817
gi 1005948959  879 LPSAPFLVGVLIHKFEVPWAKLFPLRLILRLGSKYRCYPCPVVSYRQRRPSYFEIGHTVMDILADFRNFQYTLPVIPGLT 958
gi 321454140   217 LPTPPYLVAVLLQRWEIPWAKVFPLRLLLRLGAEFRYYPCPLFSVRKRKSVFGEVGHTIVNLLADMRNFSYSLPAVAGLV 296
gi 156369922   114 LPTVPYVVGVLIQRLEAPWAQLFPLRLMLRLGTEFRYYPCPLWSVRGRPSVYGEIGHTIMNLLTDFKNFQYSIPRVTGLV 193
gi 699242898   797 VQFSSTLFALLISKSEVPWAKLFPTRLLCGLGAQFKYYPCPLVNEKIRKPIYGNIGNTILGILCDFRNYKYQVISVQGMT 876
gi 196010011  1624 IPKSPYLFGLLIHRNELVWARAFPLRLLVGLGNYYKEYPYPIWSYRDRQALFSEIGHTIMRLLIDFDSGQYTLERIPGLI 1703
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4BKW_A         234 VDMEVRKTSIKIPSNRYNEMMKAMNKSNEHVLAGGACF---NEKADSHLVCVQN--DDG------NYQTQAIS--IHNQP 300
gi 749785007  1168 IHLKNRTTDVMFPKNRYDQVIKGLHNSNDHVLAYASNF---SISADSHLVCIQT--NTGde---sNYQTQAIN--IHNKP 1237
gi 242016103   469 IHMEANQTSILIPKNRYDQVVRALKNSNDPVLALAGCF---SCEADAHLVCMQSkgTEI------TYSTQAIN--INEKP 537
gi 675855778  1458 IHVEEKKTTVIVPAYNINQVRKLVSDSDEHVVAISGNF---SSMADSHLVCLQN--SEL------NYQTQAIN--IQGRP 1524
gi 641657215   818 IHMDEKQIMVLLPRNRYDQVSRLVLASNRGILAFGANF---SAVADSHLVCVQStkDDG------NYNTQAIN--IHNKP 886
gi 1005948959  959 IHTEAKRTTVTFPKNRYDKVMKALGSSNEYVLSFGGTF---SLTADSHLTCIQN--DDG------QYHTQTIKlpVNESE 1027
gi 321454140   297 VHMEEKETNILLPKSRYQQVCKALAQSNDHVISLAASF---SPQADAHLVCLQL--DDG------SYQTQAIN--IHTRP 363
gi 156369922   194 IHMEETTTTIQLPQDRYDEVNKTQNKARKR---------------------KQHktRPGnvndlqKKKTGKVKn-IQNKA 251
gi 699242898   877 VVVKNSNVTINLPCNRFSDIIKILNSSNDHVLALGADVmasTEYSSSILTCVQNpnDSS-------YQTEV----LHDGP 945
gi 196010011  1704 VHLEKRKVTITMAMDQHDKILKVLSKSDERVLAFGANF---SPLADSVLVCTQT---DG------AYKAQIMS--RPGYD 1769
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4BKW_A         301 RK---VTGASFFVFSGALKSSSGYLAKSSIVEDGVMVQITAENMDSLRQALREMKDFTITCGKAD--A---------EEP 366
gi 749785007  1238 RT---VTGASFIVINGALKSSMGLSAKSSIVEDGLMVEIMPEKMEALKAALKNMQDFSIGCGRQG--A---------SEP 1303
gi 242016103   538 RK---VTGASFVVLNGALKTTSGVAAKTSIIEDGLMVQVPRDTMTSLRNKLRNMEDWSVKCGPIE--G---------RNA 603
gi 675855778  1525 RS---VTGASFIVFNGALKSSLGMRAKSSIIEDGLMVQLTPDDMVRLKQALLNSTSFTIKCGLLKptDathdagsavADT 1601
gi 641657215   887 RQ---ITGASFIALNGDLEDE--VSTRWRIVEDGVMVNMSSQKMALLRDALRLMKDFELNCG---------------TND 946
gi 1005948959 1028 PK---VTGASFIVFSGALKSSTGMLAKMSVVEDGLLVQVTANSLNSLKSSLKDMKDFTIECGKKD--N---------PTS 1093
gi 321454140   364 RK---VTGASFLVLNGALKSSSGISGRSSIVEDGVMVQLLPDMLSNLKQALIRMENYTIQCGKII--D---------DQP 429
gi 156369922   252 RK---VTGASFIVLTGSLKTSTPNTAKVSIVEDGLMVQMVPESILALRKALREMHDFTIKTSPST------------SNT 316
gi 699242898   946 YEedgSTAASFVVFNGSLKSSHTQLAKSTIVEDGIMVQLLPEKMELLRSALKAMEDFEIDCGHLV--K---------EEE 1014
gi 196010011  1770 RN---TIGANFIVLNCSLKSDSSSRIKTTIVEDGIMMQLNTDANRCIRDAISNMTDCTVE-GHIA------------TND 1833
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4BKW_A         367 QE-------HIHIQWVDDDKN-VSKGVVSPIDGKSMETITNVKIF----HGSEYKANG-KV---IRWTEVFFLENDDQHN 430
gi 749785007  1304 DE-------TVNIKWVDNDTL-FNLGVKSPIDGQPMDGIPSIRVH----NGTDYKGAT-RF---IRWTEVFLIKSDDHSN 1367
gi 242016103   604 EE-------VVKIIWCEDDKN-FNVGVKSVIDNMALDGVPSIRVH----SGKDFMGST-KL---IRWTQVFIIKCEDGAT 667
gi 675855778  1602 DD-------VVEIKWMSTRPD-KTFDIRSPIDGLNLSSYPCVQLHnnsnNKKHLHKSS-KLnldIICVCLYYLHKNQKSS 1672
gi 641657215   947 EQ-------TVIFHWTEDDVN-FNIGVKSCIDGRLLDGVYSIRVH----NGVDYSGKR-HF---IRWTEVFVIQCEETSD 1010
gi 1005948959 1094 EE-------SVSLVWGEDDKQ-FNLRVRSCIDGLSLEGIRSIRMY----NGTDFEGDK-FL---IRWVELFLIQNTELPR 1157
gi 321454140   430 EE-------TVTLKWVDQEPSpVNLGVQSPIDGRSFTGISSIRVM----QPRDFKGEGhRL---LRWTELFVIQIEDSAR 495
gi 156369922   317 VQ-------SVNMVWVSRNVS--SESHVSPIDGTVLTEVPSIRVH----SSCDFTRREvYR---IRWSHVFLKRGIDNPS 380
gi 699242898  1015 KEgehvprtSVCIQWISDDTK-FNIGLSSPIDYRALEGVIGYNIQ----GKSEKKDKH-FI---LRWNQVFFYQCTN--- 1082
gi 196010011  1834 EApltteddLVVIKWTPSDCT-ANLGVISHVDGMSLAGIKSLDIY----EPVLNKKKS-KTkaaLRWTKLFYLDSGSGGH 1907
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4BKW_A         431 CLS----DPADHSRLTEHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSDQ-VGYQAGSNGQ-PLPSQYMNDLDSALVP 504
gi 749785007  1368 GVS----DPVDVSKLSGNIAKATCVALVKLLDLLATAGLTKLGVRATIHPDN-VGYEAGSEGT-KLPPIYMNSLDNELIQ 1441
gi 242016103   668 SAKl--gDPLEVNNLSESIARATCIALIKLLDLLAASGLTILAVRATMDQEN-VGYEAGSNGE-KLAPIYMNSLDNELIP 743
gi 675855778  1673 PFPsdlsSDAELEKVVGDLIHCCRKAMFAELSTAKCSSHTRVCLRIHVGLDQ-IGYETGTNSSiKLSQSCLFTLDDTIIP 1751
gi 641657215  1011 RVD----EPLDTSRTAESISKATCTALVPLLDLLSAASLTPLALRIVINPDS-VGYEAGSGQN-KLPPLYMQSLDEHLVP 1084
gi 1005948959 1158 SG-----DGYDAGRAAEIIAQSFCPALVPCLESLVDNKINKIGLRVTLDSDK-IGYDVGSNGS-PLPPNYVDRLDAALVP 1230
gi 321454140   496 SSSnrieDNGDITRFAETLAKAASVALAAKLASLEPHTL--IGLRVSLDGDS-VEYQAGAGQT-SLPNACVEELDSSLIP 571
gi 156369922   381 RGV----SSRGLSRLTGDLARACCEALRAHLPGLYEGGRTCLALRVTMDTET-AEYAIGAKQE-PLPAEIMVDLDNALVP 454
gi 699242898  1083 -------DATDMGRLAEQMAQGCFQALVPHLSSLRKRGQLKIGIRINVHPDE-VGYSAGSLGV-PLPDKCLKGLDDHLIP 1153
gi 196010011  1908 AEI--------ATTFAEMLAQAIHSALEPSEELFVAKSIREFAVRVTLDGEThTEYKAGYRGQ-PLPEELIEQFDECLIP 1978

                   ..
4BKW_A         505 VI 506
gi 749785007  1442 VL 1443
gi 242016103   744 VL 745
gi 675855778  1752 LL 1753
gi 641657215  1085 VV 1086
gi 1005948959 1231 II 1232
gi 321454140   572 IL 573
gi 156369922   455 AM 456
gi 699242898  1154 LV 1155
gi 196010011  1979 LL 1980
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap