Conserved Protein Domain Family
Nop16

?
pfam09420: Nop16 
Ribosome biogenesis protein Nop16
Nop16 is a protein involved in ribosome biogenesis.
Statistics
?
PSSM-Id: 312799
View PSSM: pfam09420
Aligned: 115 rows
Threshold Bit Score: 78.858
Threshold Setting Gi: 671410513
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam09420 is the only member of the superfamily cl09664
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190356734   6 RRRKMN---RS--SITKVTRKDKDN------HKRIVVTGSDI-IRQ------------RWDKNLSMAQNYKKLGLATKTG 61
gi 470289443   6 sKRKKHytvRAavSSSKVKHRTA-Rn-----LRKVSVLHPDV--QA------------AWDKNKTLKENFASLGLVVDPN 65
gi 761910668   9 RLGKKK---IN--STSYGKK-NRKKh-----NKSDYTIKMSN-IRE------------RWNHSISMKNNLQNLGLVYDIN 64
gi 541046822  17 KNKKNA-------------SAAKKKal--krRKLAAKCASKT-ILK------------EWAKDKTLKQNLESMGLVY--- 65
gi 195109512   9 RKRYRYnvnRK--TMNKTR-------------KNTGKIKDPE-MKK------------MWLEGKRVGTNFSEMGLAR--- 57
gi 195036478   9 RKRYRYnvnRK--TMNRTR-------------SSTGKIKDPE-MQK------------LWLEGKRVGTNFKEMGLAS--- 57
gi 24651718    9 RKRYRYnvnRK--TMNKTR-------------SSTGKIKDPR-MKK------------MWMEDQRVGTNFSEMGLAK--- 57
gi 195445918   9 RKRYRYnvnRK--TLNKTR-------------SSTGKIKDPV-LKK------------LWMEGQRVGTNFSEMGLAS--- 57
gi 565387183   3 gsRRKY-------------KRSRTKvrvglpKKNPNVFKPAFsLPPklrs----lvnsHWDDKGSVIDNYKSFGVVS--N 63
gi 225437338   3 gsRRKY-------------KRSKSKvqvalpRKNPRIFKPAFsVPPklraligdssdpKWDDQGTVIRNYKSYGVVS--N 67
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190356734  62 ---SRKiRGLEEDLREKSLRLTIQQGKnphdqelrdlmeqqeqeeleksnlvvnerKIPKLGAGEAFIVR-DDKGEVVEV 137
gi 470289443  66 ---ATL------------------QLR-----------------------------AEANLAASRGLLSNgDAPGSVd-- 93
gi 761910668  65 sdiKPY-GTRTKKKQKQQEMEFMDISE-----------------------------ATSL--------------SNTTEV 100
gi 541046822  66 ------------------------------------------------------------------------DANKAIPI 73
gi 195109512  58 ------------------------------------------------------------------------DPNKAVGV 65
gi 195036478  58 ------------------------------------------------------------------------DPNKSVGI 65
gi 24651718   58 ------------------------------------------------------------------------DVNKAIAI 65
gi 195445918  58 ------------------------------------------------------------------------DPNKAVAI 65
gi 565387183  64 ---PNLlGVRCRTSHM--------------------------------------------------------IETDSLQV 84
gi 225437338  68 ---PNLlGVRSRTPQI--------------------------------------------------------IETDSLQV 88
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190356734 138 IYGkd-------------------hqTGSDEeDEEEWTGFEDKPEEEE-----TETIK---ILQERA----KR-AASNPH 185
gi 470289443  94 -------------------------lLALDA-QAAADAAEAAAGTPKV-----SEAVSvdgALEAKA----AKtASAQV- 137
gi 761910668 101 AQMe-------------------------sE-EDQTVKFKKLKGGAKA-----RTLHE---EFKKRS----AR-RNRKTC 141
gi 541046822  74 RSGmgnasdeveemeveeanargsvkEQKDRllkmkygg------psvdrakaARVIS---ALEREVrkeeKRmSKGRRY 144
gi 195109512  66 PNYkrerleav-------kivngfteEALDDdEIAILGSKKDKIESPKpk--rGHVVQ---ELEQMA----IDrRADPEF 129
gi 195036478  66 PNYkrnrle------------svkivKKLDDdELARLDSKAQAAAEEAqkpkrGHVVQ---ELEQMA----IDrRADPEF 126
gi 24651718   66 PSYkkdrllaa-------rvvngfleEELDEdERRVLGLKKPVVEEGpk---rGHVVQ---ELEQLA----SE-RADPEF 127
gi 195445918  66 PNYksqrlqtv-------kivngfveEEMDDeEIKALKGSRVTESQEpk---rGHVVR---ELEQMA----SE-RADPEF 127
gi 565387183  85 PPPkklpptsdddddadafedlddsgSEVEEdDLKS-------------------------ALGKKR----RDgKSAPLQ 135
gi 225437338  89 PQPppppsdstdaa--vsefepldsgSDQEEdDLKS-------------------------ALGKKR----RDgKNAALK 137
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 190356734 186 VQSDREQSWIEQLINKHGDDIDGMFWDKELNIYQQSRGDLKRRIKKW 232
gi 470289443 138 HQPPGVQEFVRALMERHGTNYKAMARDKELNYLQHTANQIRRKCTly 184
gi 761910668 142 HLSTLETEYLIPLIQKHGTDYGKMVRD-KGNFDQLTENQLRKKCEel 187
gi 541046822 145 RLLQQDIDFCVYMMQRHGEDYESMARDAK-NLYQDTPKQIQRKIRIF 190
gi 195109512 130 RLPKGVVKELSYFLNKHKFNYKAMVSDRR-NHGQWTWRQFRLKIRRF 175
gi 195036478 127 RLPKGVVKELTYFLGKHRFNYRAMVADRR-NHGQWTWRQFRLKIRRF 172
gi 24651718  128 RLPKGVVKELSYFLNKHKFNYKAMVADRK-NFGQWTWRQFRLKIRRF 173
gi 195445918 128 RLPKGVVKELSYFLNKHKFDYKAMVTDRR-NYWQWTWRQFRLKIRRF 173
gi 565387183 136 PLTTIQRVYISRLVEEYGDDYQSMFMDTKLNKMQHSVATLEKLCKRY 182
gi 225437338 138 PLTTIQRLHVLKLVEKYGDDYQSMFMDTKLNSMQHSVGTLEKLCKRY 184
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap