Conserved Protein Domain Family
Bcr-Abl_Oligo

?
pfam09036: Bcr-Abl_Oligo 
Bcr-Abl oncoprotein oligomerization domain
The Bcr-Abl oncoprotein oligomerization domain consists of a short N-terminal helix (alpha-1), a flexible loop and a long C-terminal helix (alpha-2). Together these form an N-shaped structure, with the loop allowing the two helices to assume a parallel orientation. The monomeric domains associate into a dimer through the formation of an antiparallel coiled coil between the alpha-2 helices and domain swapping of two alpha-1 helices, where one alpha-1 helix swings back and packs against the alpha-2 helix from the second monomer. Two dimers then associate into a tetramer. The oligomerization domain is essential for the oncogenicity of the Bcr-Abl protein.
Statistics
?
PSSM-Id: 312543
View PSSM: pfam09036
Aligned: 4 rows
Threshold Bit Score: 140.003
Threshold Setting Gi: 194332607
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam09036 is a member of the superfamily cl07596.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 612001622    3 EPADFERHWRAEFPGEPVPAMQLDSVPAMQEELERCKLNLKRLQQVLAEEKFKVIYLQTALAREKRGYDCGRW 75
gi 973206628    3 DPEEFERHWKNEFPEGQVPKMELGSVEDIERELETCKAHLRALQQQLSEEKFKVIYLQATIARQRKSYDRERW 75
gi 194332607    1 mlAGFAEAWRAQFPDAEPPRMELRTVRDMEQELERCRASVRRLERELNRERFRMIYLQTLLAKERRGYDRQRW 73
gi 47217544     3 EPVGFVEAWRAQFPESDPPYMDLNSMGDIEQELDKCRDSIRHLEKEVNKERFRMIYLQTLLAKERKSYDGQRW 75
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap