Conserved Protein Domain Family
SCA7

?
pfam08313: SCA7 
SCA7, zinc-binding domain
This domain is found in the protein Sgf73/Sca7 which is a component of the multihistone acetyltransferase complexes SAGA and SILK. This domain is also found in Ataxin-7, a human protein which in its polyglutamine expanded pathological form, is responsible for the neurodegenerative disease spinocerebellar ataxia 7 (SCA7). Ataxin-7 is an integral component of the mammalian SAGA-like complexes, the TATA-binding protein-free TAF-containing complex (TFTC) and the SPT3/TAF9/GCN5 acetyltransferase complex (STAGA). This domain is a minimal domain in ataxin-7-like proteins that is required for interaction with TFTC/STAGA subunits and is conserved highly through evolution. The domain contains a conserved Cys(3)His motif that binds zinc, thus indicating this to be a new zinc-binding domain.
Statistics
?
PSSM-Id: 311974
View PSSM: pfam08313
Aligned: 42 rows
Threshold Bit Score: 73.4149
Threshold Setting Gi: 552913970
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam08313 is a member of the superfamily cl07068.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 74604629     16 KKKKEKSTPKEKPPVDVEKQCGVPLP-NGDLCARSLTCKSHSMGAKRAVQGRSQPYDVLLASYQKKN 81
gi 242003271   252 krdkkkSERKADKIYDPDKHCGVIND-NGKPCVRSILCKVHQVALKRAVPNRTMPYDMLIKILKNQN 317
gi 556963745   271 knGHKSYKKISRKECDLKRHCGVVNPdTKTACTRLLTCKIHSVHQRREVLGRPKDFDQLVSELKAAS 337
gi 1032916853  223 rlpPKTHRKMARKEFDLNRQCGVINPeTKKICTRLLTCKIHSVHQRREVPGRTKDFDVLVAELKASS 289
gi 321460489   307 SKSDRRMLPVKERELDLEKHCGVWMSdLNRACTRSLTCKAHSLTLRRAVQGRSRSFDDLLAEHRAvk 373
gi 156403877   176 KKSPRKVIPTREREFDADKHCGVWVAdQQKKCTRSLTCKTHALSLRRAVLGRRKPFDELLAEHKARV 242
gi 260816321   206 sfdKERKIPLKDREYDPNKHCGVWLPdMKKPCTRSLTCKTHALSLRRAVPQRRKPFDELLAEHKARA 272
gi 390349809   395 tvKSDKNVPCKDRRYDPDKHCGVWSDeHKRHCTRSLTCKTHSLSLRRAVQGRRLPFNELLAEHKARS 461
gi 357631747   340 SRKSSKTKANNQREYDPNKHCGVVTAeNPKPCTRSLTCKAHALSLRRTVDGRSKPFDTLLAEHRASR 406
gi 642910620   193 HKKSKKSSTKALREYDPDIHCGVVDG-LKGPCTRSITCSNHKIQLRKSVPGRSKNIHVLIAEKKAAK 258
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap