Conserved Protein Domain Family
P19Arf_N

?
pfam07392: P19Arf_N 
Cyclin-dependent kinase inhibitor 2a p19Arf N-terminus
This family represents the N-terminus (approximately 50 residues) of cyclin-dependent kinase inhibitor 2a p19Arf, which seems to be restricted to mammals. This is a tumor-suppressor protein that has been shown to inhibit the growth of human tumor cells lacking functional p53 by inducing a transient G2 arrest and subsequently apoptosis.
Statistics
?
PSSM-Id: 311376
View PSSM: pfam07392
Aligned: 7 rows
Threshold Bit Score: 49.836
Threshold Setting Gi: 18642440
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam07392 is a member of the superfamily cl06435.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 75038996    4 RVRVTVRVSRACRPHHVRIFVAKIVQALCRASASINQGTPFQVLLIVRKKR 54
gi 77416387    4 RFVVTVRIRRTGRSPQVRVFLVQFLGSSRPRSANGTRGFVALVLRPERIAR 54
gi 77416386    4 RFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILR 54
gi 594087284   4 RFLITVRIRRANGPPRVrifVVHIARAAGEWAAPSVRAAVALVLMLVRSQR 54
gi 431914788   4 tFLVTVRIRRSRGPPQVRAFVVQFPRPAGEWASPGVRAAAALVLTLVRSQR 54
gi 18642440    1 RFLVTLRIRRACGPPRVRVFVVHIPRLAGEWAAPGAPAAVALVLMLLRSQR 51
gi 731463533   4 RFLVTVRIRRACGPPRVRSFVVHVARPAREWAAPGPRA---LVLRLVRSQR 51
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap