Conserved Protein Domain Family
PolA

?
COG0749: PolA (this model, PSSM-Id:31092 is obsolete and has been replaced by 223820)
DNA polymerase I - 3'-5' exonuclease and polymerase domains [DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 31092
View PSSM: COG0749
Aligned: 45 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 7-Oct-2002
Updated: 7-Oct-2002
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6225285  373 QIITTIAQLEALVEELKKHTDADFpVAWDTETDSLDP-LVANLVGIGCAWGQepnQVAYIPLKHhq-------------- 437
gi 15605221 287 ssiavqtvtdpvtlktvleqlkggevgycAAYTGEHL-PSLQLHGVALAGANq---VFYIEVS----------------- 345
gi 15791706 295 fkatlVQDENKLFEILNTLDKESI-IAFDTETTGLDT-KEAKIVGFSFCMNEn--EAFYVPLTHnyl-----------gv 359
gi 1169403  316 gfdvrggllesgtvgrwlAKHADDgRRSGLAIVGTHLpHGGDATALAVAAADg--nGGYIDTAM---------------- 377
gi 15893129 303 teikelnnaneLADFAKEATKIGIfGIYLLQHKGANLaFILSLQNQSYIIKIs--NTSHDLFSYnt-------------- 366
gi 15674390 297 mpqepvavisyqevtnvsadlfsaediFYFETLRDNY-HREAIIGFAWGHGEq-----IYASTD---------------- 354
gi 6166143  369 GHYRGVTDPVELKRIIDCACANGV-VAFDCETDGLHP-HDTRLVGFSICFQEa--EAFYVPLIVpdvslhtestqctcar 444
gi 17228749 363 RIINTEAKLIELVQILQQFTNPETpVAWDTETSALEP-RDAALVGIGCCWGTetdASAYIPLAHtk-------------- 427
gi 6015000    1 --------MDFEYVTGEEGLKKAIkRLENSPYLYLDTeTTGDRIRLVQIGDE---ENTYVIDLY---------------- 53
gi 9789748  319 PKKSRMIVLESAEPLSMFLEKLENpNARVFMRLVLDK--DKKILALAFLLQD---QGYFLPLEEalf------------s 381
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6225285  438 gEQLSlg---------------------iIKDLLGEILGNAIYPKVLQNAKFDRRVLAHHG--IElGGVVLDTMLASYVL 494
gi 15605221 346 --GVQ------------------------EIALLKDFFADKATQFFGYRSKRDNHALRNSGidV---HVTADLVLAEHLV 396
gi 15791706 360 gEQIS------------------------LQSAKKAIEVIFNHFVIGHNLKYDFKIIQNNFd-LNlPQKYADTMILAWLK 414
gi 1169403  378 -LTPD------------------------DDDALAAWLADPDNPKALHEAKLAMHDLAGRGwtLG--GITSDTALAAYLV 430
gi 15893129 367 kSNNNw-----------------------FSDIIFNLLTDKSIKKITYSLKPLLKFYANQShdIT---AIEDLELMQYAL 420
gi 15674390 355 -LGLL------------------------ATDSFKQVFQKP---IATYDFKRSKVLLSHLGieLV--APSYDARLANYLL 404
gi 6166143  445 sTNVEtekecteqhgvsasavqdpayvqaVMHQLRRLWNDETLTLVMHNGKFDYHVMHRAGvfEHcACNIFDTMVAAWLL 524
gi 17228749 428 gENLNqd---------------------iVLAALRPILESADYPKTFQNAKFDRLVFLVQG--INlTGVVFDPMLASYVL 484
gi 6015000   54 --EIQ------------------------DIEPLRKLINERG--IVGHNLKFDLKYLYRYG---IfPSATFDTMIASYLL 102
gi 9789748  382 pFSLEf-----------------------LQNAFSQMLQHAC--IIGHDLKPLLSFLKAKYqvPLeNIRIQDTQILAFLK 436
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6225285  495 QPEE-T-----HNLTDLCRRYnLGLVALSYKDLGLKKDQ----TIADLPLETAGQYCGLDCYATYLLASKLQKELDQYPE 564
gi 15605221 397 S-GGaK-----ISFQTLLMES-GHIQEAVFFSKEWGAGSlpvqSLP----RDPLQYFGMLASKLLAIKNYLFVKLEEKGL 465
gi 15791706 415 NPSLr------VNMDDLALRL-FNYETLHFESLVKKGEN-----FASVELEKACKYAAEDAYITLRFYLYFLKNLETPL- 481
gi 1169403  431 RPGQrS-----FTLDDLSLRY-LRRELRAETP---EQEQfsllDNVDEVDKQAIQTLILRARAVVDLAAALDAELDLIDS 501
gi 15893129 421 S------------AG-LSQKN-LFKEVLKETWI-----------------ENIIIESAKIVINFIALYKQTIWELKDNKT 469
gi 15674390 405 S-TVeD-----NELSTIARIF-TDISLEEDDTVYGKGAKravpDK-----DVLLEHLARKVKVLLDSKSQMLDKLTAHEQ 472
gi 6166143  525 DPDRgT-----YGMDVLAASF-FQIRTITFEEVVAKGQ-----TFAHVPYECAVRYAAEDADITFRLYHYLK-LRLETAG 592
gi 17228749 485 NPDT-S-----HNLTDLTQRY-LGLTIQNYVDL-VPKGK----TIADINISAVANYCCLQVYATFQLVAKLREELAKTPN 552
gi 6015000  103 GYERhSlnhivSNLLGYSMDKsYQTSDWGASVLSDAQLKyaanDVIVLRELFPKMRDMLNELDAERGEELLKTRTAKIFD 182
gi 9789748  437 NPEK-------VGFDEVLKEY-LKEDLIPHEKIKDFKTKs---------KAEKSELLSMELNALKRLCEYFEKGGLEED- 498
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6225285  565 LKEILKEIEQPLEKILAAMEDRGIRIDCDYLQTLSQQLAENLLTIETAAYEAAGESFNLSSPKQLGTILFDKLGLDRkKS 644
gi 15605221 466 -KDIFETVEQPLEAVLFAMECVGMPLDSQGLAVLDRDLTKELEECSQEIYDLVGCEFNIKSPKQLSDILYQRLGIEPv-- 542
gi 15791706 482 -LELAKNCEFDFIKIIMMMEENGIKLDTNALEILMKKFENEIKNLSEEIYTLCEDRFNLNSPKQMGDILFEKLKLPS--G 558
gi 1169403  502 -TSLLGEMELPVQQVLADMEKAGIAADLRLLTELQSQFGDQIRDAAEAAYAVIGKQINLSSPKQLQVVLFEELGMPKt-- 578
gi 15893129 470 -FRLYSNIDLPICFILDKMEKVGITVDANYLKQLSAEFGTEILKLEEEIFALSGTKFNIGSPKQLGEILFEKMQLPF-GK 547
gi 15674390 473 -LDLYQNIELPLANVLAKMEIEGIKVNRATLQDMAEQNKVIIEALTQEIYDMAGQEFNINSPKQLGSILFEKMQLPLeMT 551
gi 6166143  593 LLSVFETIEMPLLPILARMEEVGIFLRKDVVQQLTRSFSDLIQQYEHDIFSLAGHEFNIGSPKQLQTVLFQELHLPP-GK 671
gi 17228749 553 LDKLLREVEQPLESVLATVEYTGVRINSAYLHELSQQLEIDLAKLQEQATELAGEKFNLGSPKQLSYILFEKLGLSTkYS 632
gi 6015000  183 LKSPVAIVEMAFVREVAKLEINGFPVDVEELTNKLKAVERETQKRIQEFYIKYR--VDPLSPKQLASLLTKKFKLN---L 257
gi 9789748  499 LLTLARDIETPFVKVLMGMEFQGFKIDAPYFKRLEQEFKNELNVLERQILDLIGVDFNLNSPKQLGEVLYDKLGLP---- 574
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6225285  645 RKTKTG-YSTDHATLEKLQG--DHPIIDAILEHRTLAKLKSTYVDALPELVNGQT-QRIHTDFNQAVTSTGRLSSSNPNL 720
gi 15605221 543 DKAKS----TKAEVLEALEDr--HEIIPKILMFRATEKMLSTYVRALPKQINAGT-QRIHPTFNQVGTVTGRLSCQDPNL 615
gi 15791706 559 KKGKTG-YSTDEKVLNILLD--KHPVIAKILDYRELAKLYSTYCEPLLKLALKDKnSRIYSSFLQTGTATGRLSSKDPNL 635
gi 1169403  579 KRTKTG-YTTDADALQSLFCktEHPFLQHLLTHRDVTRLKVT-VDGLLNAVAAD--GRIHTTFNQTIATTGRLSSTEPNL 654
gi 15893129 548 ASAKASsYSTGAEILEKLSEh-GYNIADLLLRWRQLTKLKNTYTDSLPKQIDNIT-HRVHTTFLQTSTTTGRLSSQEPNL 625
gi 15674390 552 KKTKTG-YSTAVNVLERLAPi--APIVAKILDYRQITKLQSTYVIGLQDYILAD--GKIHTRYVQDLTQTGRLSSVDPNL 626
gi 6166143  672 KNTQG--YSTDHSVLKKLAr--KHPIAEKILLFRDLSKLRSTYTESLAKLAD-QT-GRVHTSFVQIGTATGRLSSRNPNL 745
gi 17228749 633 RKIQTG-YSTDAATLEKLQEvdDTGFVNAIIEYRTLSKLKSTYVDALPALVRPDT-QRVHTDFNQTATSTGRLSSSNPNL 710
gi 6015000  258 PKTPKGnVSTDDKALTSYQD---VEPVKLVLEIRKLKKIADKLKELKEHLKN----GRVYPEFKQIGAVTGRMSSAHPNI 330
gi 9789748  575 -KNKS--HSTDEKNLLKILD--KHPSIPLILEYRELNKLFNTYTTPLLRLKDKD--DKIHTTFIQTGTATGRLSSHSPNL 647
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6225285  721 QNIPIRSDFSRQIRRAFLPQ---KDWLLVS-ADYSQIELRILAHLSQEPVLLQAYGDRQDVHGVTAKLLFGKED---ITP 793
gi 15605221 616 QNIPVRSERGRSLREAFRVKk---DNDYFLaADYSQIELRFLAHLSQDEMLKRAFNSGEDIHAFTASQVFNVPLe-qVTK 691
gi 15791706 636 QNIPAHGQYAKDYKSCFVAK---DGFSFIS-LDYSQIELRILAHFSEDEKLLNAFANDEDIHARTAIMIFGe-----SNY 706
gi 1169403  655 QNIPIRTNAGRQIRDAFVVGsenNGYTELMtADYSQIEMRIMAHLSRDEGLIEAFHTGEDLHSFVASRAFGIPIe-dITP 733
gi 15893129 626 QNVPIRSSEGNQIRKAFIAE---EGYKLIS-ADYSQIELRILSHIANIDALKQAFINKDDIHTQTACQIFNLQKh-eLTS 700
gi 15674390 627 QNIPIRLEQGRLIRKAFTPSh---EDAVLLsSDYSQIELRVLAHISGDEHLIAAFNEGADIHTSTAMRVFGIDRaadVTA 703
gi 6166143  746 QNIPIKSTEGRKIRQAFQAT---VGHELIS-ADYTQIELVVLAHLSQDRNLLNAFRQHIDIHALTAAYIFNVSId-dVQP 820
gi 17228749 711 QNIPIRTAFSRQIRKAFLPE---SGWLMAA-ADYSQIELRILAHLSQEPLLVQAYQQNEDIHTVTAKLVFEKED---VNS 783
gi 6015000  331 QNIHR------DMRGIFKAE---EGNTFVI-SDFSQIELRIAAEYVKDPLMLDAFKKGKDMHRYTASVVLGKKEe-eITK 399
gi 9789748  648 QNIPVRSPKGLLIRKGFIASs--KEYCLLG-VDYSQIELRLLAHFSQDKDLMEAFLKGRDIHLETSKALFGe----dLAK 720
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6225285  794 AERNLGKTINFGVIYGMGAQRFARETGISA------VEGREFIDRYHRTYAQVFDYLETMKLEAIAKGYVT--TIVGRRR 865
gi 15605221 692 QQRYQAKAVNFGLVYGQQAYGLSKILKISV------SEAQGLMDAYFARYPLAAEFITQTIEQASKNQKVT--TMLGRER 763
gi 15791706 707 ETRSVAKSINFGLIYGMGYKTLSQNLKIEA------NLAKSYIEKYFENFTSIKKYFEKVKNEAKQNGFIV--TLSGRKR 778
gi 1169403  734 ELRRRVKAMSYGLAYGLSAYGLATQLKIST------EEAKLQMEQYFARFGGVRDYLMDVVEQARKDGYTS--TVLGRRR 805
gi 15893129 701 EHRRKAKAINFGIIYGISAFGLAKQLNVTN------GEASEYIKKYFAEYKGVQEYMEQTKAFASSNGYVT--NCFGRKC 772
gi 15674390 704 NDRRNAKAVNFGIVYGISDFGLSNNLGITR------KQAKSYIDTYFERYPGIKAYMENVVREAKDKGYVE--TLFKRRR 775
gi 6166143  821 AMRRIAKTINFGIVYGMSAFRLSDELKISQ------KEAQSFIYRYFETYPGVYAFSTQVAEQTRKTGYVT--SLAGRRR 892
gi 17228749 784 DERRIAKTINFGVIYGMGSLKFSRSTGIDK------NVANEFIKRFNERYAKIFAYLEGVKKQAISLGYVE--TILGRRR 855
gi 6015000  400 EERQLAKAINFGLIYGISAKGLAEYAKLGYgveislEEAQVLRERFFKNFKAFKEWHDRVKKELKEKGEVKghTLLGRRF 479
gi 9789748  721 EKRSIAKSINFGLVYGMGSKKLSETLSIPL------SEAKSYIEAYFKRFPSIKDYLNGMREEILKTSKAF--TLLGRYR 792
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6225285  866 YFNFVTEALRQLRgktvteldl-vdvkmnyndAQLLRSAANAPIQGSSADIIKIAMVKLAKLLESY--QTRMLLQVHDEL 942
gi 15605221 764 ILSDWESSP-GAR-------------------AASGRLAVNTRIQGSAAELIKLAMLNISDEMRSRglKSRLLLQIHDEL 823
gi 15791706 779 YFDFENAKPMQIA--------------------MYERESINSILQGSAADVIKLAMLEINKELNEDk---KLILQIHDEL 835
gi 1169403  806 YLPELDSSNRQIR-------------------EAAERAALNAPIQGSAADIIKVAMIAVDKSLKQAklASRMLLQVHDEL 866
gi 15893129 773 FVPLIHDKK--LK-------------------QFAERAAINAPIQGTNTDIIKIAMINLDQEIEKRklKTRLVLQIHDEL 831
gi 15674390 776 ELPDINSRNFNVR-------------------SFAERTAINSPIQGSAADILKIAMINLDKALQAGgfRAKMLLQVHDEI 836
gi 6166143  893 YIRTIDSRNTLER-------------------ARAERMALNTQIQSSAADIVKIAMIAIQRAFARRplRAQLLLQVHDEL 953
gi 17228749 856 YFDFTNNSLRKLKgskpedidlsklknlgpydAGLLRSAANAPIQGSSADIIKIAMVQIHEVLKKY--QARLLLQVHDEL 933
gi 6015000  480 SANTFN--D-----------------------------AVNYPIQGTGADLLKLAVLLFDANLQKKgiDAKLVNLVHDEI 528
gi 9789748  793 -VFDFTGVNDYVK-------------------GNYLREGVNAIFQGSASDLLKLGMLKVSERFKNNp-SVRLLLQVHDEL 851
                       650       660       670       680
                ....*....|....*....|....*....|....*....|....*..
gi 6225285  943 IFEMPPEEWEELAPLIQNTMEQALT---LSVPLVVEMHRGSNWMEAK 986
gi 15605221 824 LFEVPAEELEEMRSLVQEKMESAME---LSVPLVVNVLIGKNWAEC- 866
gi 15791706 836 IFEVKDDLCENFVKKTRDIMENIVK---LKVKLKTSSSIAKNWGDLK 879
gi 1169403  867 LFEVAIGEREQIEAMVREQMGSAYP---LDVPLEVSVGFGRSWGAAA 910
gi 15893129 832 LFEAPIDEVEIITPIIKKIMENSTN---MAVPIITEIRAGNNWMEIH 875
gi 15674390 837 VLEVPNDELTAIKKLVKDTMEAAVD---LAVPLCVDESTGHSWYEAK 880
gi 6166143  954 IFEAPAAETAIVKEILFAEMEHAVE---LSIPLRIHVESGNSWGDFH 997
gi 17228749 934 VFEVPPQEWAELQPQIKSVMENAVK---LSVPLVVDVRAGENWMETK 977
gi 6015000  529 VVECEKEKAEEVKEILEKSMKTAGKiilKEVPVEVESVINERWTKD- 574
gi 9789748  852 IFEIEEKNAPELQQEIQRILNDEVYp--LRVPLETSAFIAKRWNELK 896
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap