Conserved Protein Domain Family
L6_membrane

?
pfam05805: L6_membrane 
L6 membrane protein
This family consists of several eukaryotic L6 membrane proteins. L6, IL-TMP, and TM4SF5 are cell surface proteins predicted to have four transmembrane domains. Previous sequence analysis led to their assignment as members of the tetraspanin superfamily it has now been found that that they are not significantly related to genuine tetraspanins, but instead constitute their own L6 family. Several members of this family have been implicated in human cancer.
Statistics
?
PSSM-Id: 310416
View PSSM: pfam05805
Aligned: 91 rows
Threshold Bit Score: 103.416
Threshold Setting Gi: 620981847
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam05805 is a member of the superfamily cl05399.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62900758    1 MCTGGCARCLGGTLIPLAVFAVLANILLFFPG-GKVVD--Dn--SHLSDEVWYFGGILGSGVLMIfPALVFLGLQNND-C 74
gi 395528125   2 TCTEGFTSCNGFSLMVLALLAVVLNTIPLISYkLQSDE--Ls-kNPISCFEWWYPGIIGAGVLVI-PATIMSLAARKR-A 76
gi 126338314   2 TCYDGWTSCNGFSLLVLLILAIALNIIPLAVY-TVERN--EkfrNPISCFEWFFPGVIGAGLLAI-PATVMTLSARKR-N 76
gi 573900632   2 TCCEGFTSCNGFFLISLCILAIAFNLLPLFAD-YSMDGr-Lf-qKPVSCFEWWLPGVLGGGILVL-PAVAMTFAAKKRg- 76
gi 149563222   2 TCCEGLTSCNGFSLLILVLISVGLNMVPLISD-YAQDG--LllhNSISCYEWWLPGIMGAGFLGL-PAVAVSLAARKRg- 76
gi 157422990   9 TCTEGWSSCNGFFLLILSLLAIAFNLTPLIAD-YVEDGr-Lf-vSPISCYEWWLP-GLVGGGLLVlPAVSMTLAARKKg- 83
gi 558099994   2 TCCEGWTSCNGFSLLVLLLSGVALNAIPLIVN-RLEEGefFk--NPISCFEWWFPGIIGAGLMAI-PATTMSLAARKRaC 77
gi 73994102    2 TCCEGWTSCNGFSLLVLLLFGIVLNAIPLIVN-FVDEGqfFh--NPISCFEWWFPGIIGAGLMVI-PAATMSLAARKRaC 77
gi 395823699   2 TCCEGWTSCNGFGLLVLLLLGVILNAIPLVMN-LLEQDqfFq--NPISCFEGWFPGIIGAGLM----------------- 61
gi 301768693   2 TCCEGWTSCNGFSLLVLLLLGIVLNAIPLIVN-VVDEGqfFh--NPISCFEWWLPGIIGAGLMVI-PATTMSLAARKRaC 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62900758   75 cgccgnesCGKRFAMFTSTLFAVVGFLGAAYSFIVSAVSINKGPK-CFMtNNT--------------------WGypFH- 132
gi 395528125  77 c-------CNNRLGMILSSFLSLVTIGGAVYCILVSALALSEGPLiCNYnGNStfn---------------ceFS--MK- 131
gi 126338314  77 c-------CNNRFGMFLSSVLSLVTIGGAFYCMLTSLMALSEGPLiCNYhGNStvq---------------cdLSmaMK- 133
gi 573900632  77 -------sCNSRTGMLLSAFFCIISIVGAIYCVLISLIALASGPLiCQDpDAGl-------------------sSctFSl 130
gi 149563222  77 -------sCNSRTGMLFSSFLSSVSIIGASYCLVVSLHALSEGPLiCNPnGNDlsncvfslknlsnfqeqafqLDwfFK- 148
gi 157422990  84 -------sCNSRGGMLASALLSVFSIIGAVYCTIISLFAVAKGPLiCETgSNEls-----------------sCDytLG- 138
gi 558099994  78 --------CNNRGGMFLSSFLNIITILGAVFCVLVSLQALFKGPLiCNSpGNStc-----------------eFS--VD- 129
gi 73994102   78 --------CNNRTGMLLSSLLNVITIIGAVYCILVSIHALIEGPLiCNSeGNStsn---------------ceFS--FS- 131
gi 395823699  62 --------------MFLSSLFSVITILGAVYCMVVSLQALSEGPLvCSLpANSsaq---------------ceFS--FK- 109
gi 301768693  78 --------CNNRTGMLLSSLLNVLTVIGAAYCMLVSTQALLEGPLiCNSpENStps---------------ceFS--FS- 131
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62900758  133 ---------D-------------G-----D----------YLND---------QAlw----------------------s 144
gi 395528125 132 ---------NlsdihdqlqqpitL-----R----------WFFS---------PTcepeipnnsvpdnstnlfqrtntlt 178
gi 126338314 134 ---------Nisnir----nqfdL-----Q----------WFYF---------PT------------------------- 151
gi 573900632 131 gnisslstlNf-----------dI-----G----------WYLQ---------FDgchnstggegn----gtwvplghsf 171
gi 149563222 149 ---------Gn-----------cGltipdN----------FITNndimglhrsKSsr----------------------s 176
gi 157422990 139 ---------Nl-----------sS-----NsfkelrfdlaWLLN---------TT------------------------- 159
gi 558099994 130 ---------Klriyp----qsfnL-----Q----------WYFN---------GS------------------------- 147
gi 73994102  132 ---------Nlsdth---peffnL-----Q----------WFYK---------ES------------------------- 150
gi 395823699 110 ---------Nltnih---pesftL-----Q----------WFYN---------NS------------------------- 128
gi 301768693 132 ---------Nlsdih---pesfnL-----Q----------WFFS---------EA------------------------- 150
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62900758  145 kCE-------------------------EPR---------------------------D--------------------- 151
gi 395528125 179 vSS-------------------------EEN---------------------------R--------------------- 185
gi 126338314 152 -CQpgyrnssaidfntnsfqskgftfssEEN---------------------------R--------------------- 182
gi 573900632 172 tNL-------------------------DES---------------------------Q--------------------- 178
gi 149563222 177 fGS-------------------------DEN---------------------------E--------------------- 183
gi 157422990 160 -CL-------------------------PRV---------------------------Dpaitaaqgiiherdlsielne 186
gi 558099994 148 -CV-------------------------APNslnssttndtma----sdlkkynlqekR--------------------- 176
gi 73994102  151 -CI-------------------------APTdytnltvnsimpsgwrehslhfnskenK--------------------- 183
gi 395823699 129 -CL-------------------------LPVlnnptf----------------sdttsQ--------------------- 145
gi 301768693 151 -CV-------------------------SPTdvtdpttngitagdwrkhtlhfdskenK--------------------- 183
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|..
gi 62900758  152 --VVPWNLTLFSILLVIGGIQMVLCAIQVINGLLGTLCGDCQ 191
gi 395528125 186 --YKIIHLTVFVGLFLVGILEILFSISQIVIGLFGCLCGVSK 225
gi 126338314 183 --HRVIHFTVFAGLFLVAVLEIFFSFSQIVIGLYGCLLGVSK 222
gi 573900632 179 --IVNLHLITFSGLSVVALLEIIFSLLQIVAGICGCLCGTSK 218
gi 149563222 184 --PKILHLSVFIGLFTTGVLEILFSISQIMVGIFGCICGTSa 223
gi 157422990 187 dtQKIIHITVFVALAIIGLVEALVAISQAVAGLFGFICGTSK 228
gi 558099994 177 --HKTIHLSVFVGLLLVGSLELVCALSQIVIGFLGCLCGVSK 216
gi 73994102  184 --HRTIHLTVFLGLLLVGILELLVGFSQIVIGFLGCLCGVTK 223
gi 395823699 146 --HTVIHFSVFLGLLLVGILEVLFGLSQIVIGFLGCLCGVSK 185
gi 301768693 184 --YRVIHFSVFLGLLLVGILELLFGLSQMVIGFLGCLCGVSK 223
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap