Conserved Protein Domain Family
Cytochrom_B558a

?
pfam05038: Cytochrom_B558a 
Cytochrome Cytochrome b558 alpha-subunit
Cytochrome b-245 light chain (p22-phox) is one of the key electron transfer elements of the NADPH oxidase in phagocytes.
Statistics
?
PSSM-Id: 309953
View PSSM: pfam05038
Aligned: 8 rows
Threshold Bit Score: 276.679
Threshold Setting Gi: 326927542
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam05038 is a member of the superfamily cl04901.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20137189     9 WANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVLICLLEYPRGKR-KKGSTMERCGQKYLTAVVKLFGPLTRNY 87
gi 557015744    9 WANEQALAAGIVMLIGGIVGVAGQFKNWQFAAYGIAAGVFICLLEYPRGKR-TKGTNMERPGQKYMTAVVKVFGPLTRNY 87
gi 13162359     9 WANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVLICLLEYPRGKR-KKGSTMERCGQKYLTAVVKLFGPLTRNY 87
gi 326927542    9 WANEQALAAGLIMLTGGVVAVAGQFKGWYFAAYAIAAGAFVCLLEYPRSKR-QKGSTMERCGQRYMTAVLKVFGPLTRNY 87
gi 1033379395   9 WANEQALASGLILVAGGIVAVSGQFKRWEFAAYAIAAGVFICLLEYPRGKR-KKGSTMQRCGQQYFTPVVKVFGPLTRNY 87
gi 573907163    9 WANEQALASGLILLAGGIVGVAGQFRGWEFAAYGVAAGVFVCLLEYPRGKRmSKGTNMERTGQRCLTICVKAFGPVTRNY 88
gi 551506942    9 WANEQALASGLILLAGGIVGVAGQFRGWEFAAYAVAAGVFVCLLEYPRGKR-AKGTSVERTGQYCFTVCVKAFGPLTRNY 87
gi 821462502   15 dpdsvspslstVLLTGGIVATAGQFIWWQFGAYSIVAGVFVCLLEYPRGKR-KKGFTMERCGQKYLTSVVKAFGPLTRNY 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20137189    88 YVRAVLHLLLSVPAGFLLATILGTVCLAIASVIYLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKP 167
gi 557015744   88 FVRAGLLAGLAVPGGFILATVLGTVCLGIASIIYLLAAFRGEQWKPIELKTVQKTRLEESITKPPMNPPPRPPADFRRKP 167
gi 13162359    88 YVRAVLHLLLSVPAGFLLATILGTVCLAIASVIYLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKP 167
gi 326927542   88 YIRAILHAALAVPAGFLLSTILGTVCLGIASGIYLLAAVRGEEWRPIEQKPRERPHMGDTIKQPPSNPPPRPPADARRKQ 167
gi 1033379395  88 YVRSILHACLAVPAGFLLATILGTVCLAIASGIYLLAATRGEEWQPIESKPKERPQVGGTIKHPPTNPPPRPPPDARKKP 167
gi 573907163   89 YVRAVLHAILSVPGGFILPTVLGCVCLGIASLIYLAAAIRGEQWEPILPQTVTKERIGQSIKQPPQNPPPRPPVDVRRKR 168
gi 551506942   88 YVRAFLHAAICVPGGFMLATVLGCVCLGIASLIYLAAAIRGEHWEPILPRKEVRKPVAESIKNPPQNPPPRPPPEMRRKQ 167
gi 821462502   94 YIRALLHLCLAVPAGVLLATILGTVCLAIASAIYLLAAIRGEEWKPIEQKVIERAQVGTTIKQPPSNPPPRPPAEARKKQ 173
                         170       180
                  ....*....|....*....|....*...
gi 20137189   168 -----SEaeeeaASAGGPQVNPIPVTDE 190
gi 557015744  168 -----ED-----LSSGGVHVDPIPATLN 185
gi 13162359   168 seaeeEA-----ASAGGPQVNPIPVTDE 190
gi 326927542  168 -----VV-------EVGGQVNPIPVEVe 183
gi 1033379395 168 -----PE------DGAGGQENPIAVEVE 184
gi 573907163  169 -----TD-----DAEGAAYVNPIPVTAS 186
gi 551506942  168 -----AK-----DLESAAYDNPIPVTSD 185
gi 821462502  174 -----PEee-aaGPSGGPQVNPVTVTDE 195
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap