Conserved Protein Domain Family
TauC

?
COG0600: TauC (this model, PSSM-Id:30945 is obsolete and has been replaced by 223673)
ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism]
Statistics
?
PSSM-Id: 30945
View PSSM: COG0600
Aligned: 92 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 7-Oct-2002
Updated: 7-Oct-2002
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15595383  23 PSAAFARRLGd--GLLPWLLPLGLALLWWVASHRH-----WMSAQVLPTPELVWQ-----SARELLAG-----ELWSELA 85  Pseudomonas aerugin...
17988022   3 DAVPNRSRLKr--AADGFLSVAAALAIWQAVVSIG-----QMPRFILPGPLDVVH-----ALVANAR------LIAENAA 64  Brucella melitensis
16080114  16 QFKQKKEKWKv--HSFQLAIFILFFSGWEISSRQG-----WIDPLIFSSPSAVWR-----LLLEKLGd----gSLLSHIG 79  Bacillus subtilis
15893404   1 -MQKRSTTVTg--IFRRVLFYIILIAIWELIYKVFvdilgVWKAYTFPSPGEVYN-----ALAYLVKDn----TLFIATG 68  Clostridium acetobu...
16126075   1 MRLLNIRPRGglaVMLGAVPLLAAGLLYLMASQARha--eNPRDKLLPTPEAMAEavqlmARVDPLTGh---aPLLVDTL 75  Caulobacter crescen...
17545099  28 WRDWLAAAVVk--GFPPMLGFALFVLAWQGIAMAIp----ALPTPALTWKAAVAL-----FADPFYRNgpndqGVGWNVL 96  Ralstonia solanacearum
16263930   2 DCSCTLNKTLqhpALVRALSLGLLLLLWIAAAGFT------DDASVLPQPWALWEp-----FVQAVSSg----ALPYHLG 66  Sinorhizobium meliloti
15642976   1 --------------MRAVFGILLVLIAWYLLHFLFp------SSLILPGPVETFK-----VFIKMLNR-----ETFEALL 50  Thermotoga maritima
17230779   1 ----------------------------------------------------------------------mdqSIFLDVL 10  Nostoc sp. PCC 7120
13471349  18 VRQERLERVGr--WVLPLAIMILAIWLWDRICVWD-----EIPQYILPRPGVVLQ-----TLYNDAG------LLFSSLL 79  Mesorhizobium loti
15595383  86 ISLRRLAWGLLAGVASGAALGAWLGFSPRAERLVFPTFSALAQIPTLAWIPLFMLFFGIGELL-KLVVLVKAVVVPVTIH 164 Pseudomonas aerugin...
17988022  65 ATIGEVLGGLVLGSAVGIAAAIGLMMSPLAQRLVMPVMVFSQAIPIFALAPILTLWLGYGPAS-KIAVAVLMIFFPVVST 143 Brucella melitensis
16080114  80 VTLFETVLGFLLGTFMGTCLAALLWWSNRLARILDPYLVILNAMPKVALGPILIVALGPSFIS-IIAMGAIISVIITTIV 158 Bacillus subtilis
15893404  69 ASLTRLVIGYIIALFIGIALALVCIKYKYVDENLTPLMLGLQTLPSVCWIPFAILWYGIDERS-IIFVTVVGSLFSIAIS 147 Clostridium acetobu...
16126075  76 ASLERMGLALAIATAVSLLLGLSLGLLPLLRAKFGPLVAGIAVIPPIAVLPILFIVFGLGETA-KIALIVFGVAPVMVRD 154 Caulobacter crescen...
17545099  97 SSLARVGAGFGMAAVIGIPAGFLLGRFAFLNAMASPIISLLRPVSPLAWLPIGLLLFKSANPAaIWAIFI-CSIWPMVIN 175 Ralstonia solanacearum
16263930  67 MTLWRVICAFVPAMVIGVAIGFLMGRVAAVDRWLDPWLVVFLNLPALVLIVLCYIWIGLNETA-AITAVVLNKIPNVATL 145 Sinorhizobium meliloti
15642976  51 STLLKGLVSTFIVIAVGLPVGFFMGISDRVYEFLRPLVTVVQAVPVVSWLVVVIFLWGIGWQG-PVVISSLSLIPVAIFT 129 Thermotoga maritima
17230779  11 TSLQKLFVGYIPAAIFGSFIGYLIGINVAVYQLMRRIFQIPNSIPPIAILPLTLVIFQESESA-VAVVIFMASLWTIIIN 89  Nostoc sp. PCC 7120
13471349  80 VTLRITFLSLALAVIGGVGLSVLFAQSKWVEMSFFPFAIVLQVTPIVAIFPLINIYVNNQTTK-LLLCAWIVAFFPILSN 158 Mesorhizobium loti
15595383 165 TLVGVRDAQPKLREAAAVLRLPPRLLVWRLILPAALPAFLTGLRLALAQGWTSLLAVELLASS----EGIGYLMVQGRQL 240 Pseudomonas aerugin...
17988022 144 FFDGMRCTETGLIEAAEILGAGRMAILFRIRIPSAFPALASASALPPSMPPSGRWWANGSALP-----GASAI------- 211 Brucella melitensis
16080114 159 VYTAFQEVDENYTKVMKTFGAKKWVIFKEVILPASSPAIISTLKVNVGLSWVGVIVGEFLVSk----VGLGYMIIYGFQV 234 Bacillus subtilis
15893404 148 TISGVKNVNPIYVKAARTMGARGKNLYFDVVIPSALPEIISGMRQGWSFAWRALMAGEMLSAT----KGLGQVLTAGREL 223 Clostridium acetobu...
16126075 155 LAAHVAAIPEEQLVKAQTLGSSTWQLALRVALPQAMPRLIDSLRLSLCPAWVYLISAEAIAAD----VGLGYRIFLVRRY 230 Caulobacter crescen...
17545099 176 TAVGVTRVPQDYLNVARVLNLSEWKIFTRVLFPAVLPYMLTGVRLSIGTAWLVIVAAEMLTGG----VGIGFWLWDEWNN 251 Ralstonia solanacearum
16263930 146 LREGARALDPDLDSMAAVYRMRPLARLRHVIMPQLAPFIAAAARSGIAVIWKIVLVVEFLGRS----SGIGFQIHFYFQL 221 Sinorhizobium meliloti
15642976 130 TVSGVRSVDRKLLEVMKVYRVPRRMILKEVYLGSIWPFVLSILEVSSGNVWKAVVMGEYLCGD----SGLGVLISWARQY 205 Thermotoga maritima
17230779  90 TAVGIQHFRRQNNNFRAVIFHTS-----------------HALKVGIWVAWFTVIAVEMLLAS----KGLGALLWNSYKS 148 Nostoc sp. PCC 7120
13471349 159 TTLGLNSVDRNLRDLFKLNGATRWQQLRYLRLPAAMPYFLGGLKIAGGLSLIGAVVAEFVAGAtgqsSGLASRIIEAGYR 238 Mesorhizobium loti
15595383 241 FMLDIVFVCILIIGLVGVGMDRAIQ-WLDRRLLH-WPQAAT 279 Pseudomonas aeruginosa PA01
17988022     ----------------------------------------- Brucella melitensis
16080114 235 FNFTLVFLSLLIIAIFATLMYQGVE-LLEKKWTK-GRT--- 270 Bacillus subtilis
15893404 224 GDISQVMAVMIIIIAFGLIFDKLLFeKVEKNIRYkCGLEKK 264 Clostridium acetobutylicum
16126075 231 LSMDIILPYVAWISLLAVIMDVTLR-LISRRAYP-WAYPER 269 Caulobacter crescentus CB15
17545099 252 LKVEHIVIAIFVIGVVGLLLEQALL-AVARRFSY-DAI--- 287 Ralstonia solanacearum
16263930 222 FNVAMVLVYALSFIGVMLLVEAFFLqPAERRVRR-WRTA-- 259 Sinorhizobium meliloti
15642976 206 VDVPRVYALTIFTVVLGISFERSVK-VLARRVWKkWRLS-- 243 Thermotoga maritima
17230779 149 GNSNYIIEGILYIGIIGFLLDQFID-YTGYLLAQmVTDSKK 188 Nostoc sp. PCC 7120
13471349 239 LNAPRLFAALFLISLTGILIFLVLS-LISHLILRrWHESAL 278 Mesorhizobium loti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap