Conserved Protein Domain Family
BESS

?
pfam02944: BESS 
BESS motif
The BESS motif is named after the proteins in which it is found (BEAF, Suvar(3)7 and Stonewall). The motif is 40 amino acid residues long and is composed of two predicted alpha helices. Based on the protein in which it is found and the presence of conserved positively charged residues it is predicted to be a DNA binding domain. This domain appears to be specific to drosophila.
Statistics
?
PSSM-Id: 308542
View PSSM: pfam02944
Aligned: 97 rows
Threshold Bit Score: 30.4243
Threshold Setting Gi: 195455889
Created: 18-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam02944 is a member of the superfamily cl03793.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 74871560  200 ESNRHFLLSMVPMLRSLSDRSKERFRSWTRRVLRE 234
gi 121995117 242 DADYNFLLSLMPHMKSLSDMGNLKFRMEVSRILVE 276
gi 357623832 174 DADRHFLLSLIPSFQTMAEDDKLTAKVEILKVIKN 208
gi 642934122 174 KSDHYFMMSVVHDCQSLPPRKKLKFKKDVLGLLEK 208
gi 198429024 173 DADELFFASVLCEISGLPPKKKGKLKIDIMNLVHN 207
gi 195034912 234 DPDRSFLVSLLPHVKMLTPMNNMKFRMEVTRLLMD 268
gi 195171596 198 DADYNFLASLIPHLKSLSETGKLKFRMEASRILME 232
gi 968081032 288 DADYNFLVSLLPHVKSLSDIGNLKFRMEISRILLD 322
gi 195356770 236 DSDLSFLMSMVPHVKSLSAISNLKFRMEMARVLVE 270
gi 195114222 235 DPDYNFLISLLPHVKTLSSMNNMKFRTEVSRMLME 269
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap