Conserved Protein Domain Family
SpoVK

?
COG0464: SpoVK (this model, PSSM-Id:30812 is obsolete and has been replaced by 223540)
ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 30812
View PSSM: COG0464
Aligned: 107 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 7-Oct-2002
Updated: 7-Oct-2002
Structure
?
Aligned Rows:
COG0464 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   430 ALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALAAScss----deRKITfFMRKGADILSKWVGEAERQLRLLFE 505
gi 15791744    1 ---MEKLKNFLILKNIEDTQIYKELKCAKNEALILRELCRN---------YVVSiSSINAFTLLSTIFGNDKYLYLDALE 68
gi 19074884    1 ----------------------------------------------------MRdLETSKSYKVDKKTNEDEEEYEEMRD 28
gi 7388514   163 wpdvlaqfpeatqwrhpelkaagaamattalaslgvfeeafrraqeaiegdrvpgaanialytqgmclrhvgreeeavel 242
gi 17546680  235 EPPLPENSVTDLGDLMRISDRLLHVLLGDYACEAEMMAVFTrpappttltQADYpHVETDARYLAALLESATRQRAMGVN 314
gi 16263937      --------------------------------------------------------------------------------
gi 9755327     1 -MSYIVDLQVRGSSLRVIKCMFREDEQISSLHSGSDSKQNSn-------kKLGEfLNLLKAVVKRKLESFPKDRLKTSII 72
gi 17231725    1 -----------------------------------------------------MlIFEEHFQDNRCSWVTRDSEECSLCM 27
gi 17158664   20 ACESPLQERHRFLIRLTTSCQQVGKKIYIWNLSEDSIKELAv--------STENnLVFQEFEDYKHSVKQNTEDYFQVLN 91
gi 13472456  121 PLEGDEASAFKKLLSASAYISAFSLASYLFQLIDSDGEAPNd--------IPEPdFLFDTPQDAVKSILAGLDKAIAGSK 192
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   506 EAKKHQP--------SIIFFDEIDGLAPVRSS---KQEQIHASIVSTLLALMDGMDn-----RGQvIVIG---ATNRPDA 566
gi 15791744   69 DLKKLIErgfv-nqnSSFFKSLENNKTQTLTLallQSELSLSEYFLEFLEAKPRLNfekqeaYADyLEYLkdeFARIQLY 147
gi 19074884   29 RTKKNKP------------EGKRKNINNEILG-----ALIYRKILRDYGIKQKKTNk----------------NSKPTKS 75
gi 7388514   243 lrrvysrdakftparealdnpnfrliltdpetieartdpwdpdsaPTRAQTEAARHae--maAKYlAEGDa--ELNAMLG 318
gi 17546680  315 ILLYGAPgtgktelaRVLARDAGCELYEVDCLdkdGNSLSGKDRYRSLQVSQAFLRg-----RSRaVLLFdevEDVFPGP 389
gi 16263937    1 -----------------MLMPDAPSNTESLPT---SVDLAGEYQASGVAEILDELD-------------------RELVG 41
gi 9755327    73 TGQELMRe-------GQGSIEIKDPPTEAQQHlirSLAKVLLHQFSSINGKVNTVNeg---qDNLfLSLFvkkISIEQQS 142
gi 17231725   28 DVSHYVFdhkragdtYWLSWNSAEFFYERTNFhihIVLEKAAGVDDHGYGFVWGLSdv--snFFEfVISGn-gHYRITEI 104
gi 17158664   92 FWRVYSg-------tGVLIVENIFPWLKESITkdtEFILLSEWIKSSLVNLKFHTNn----------------SDKTTIL 148
gi 13472456  193 DDADLATrar---afARVAIDGLLARKGRFDGigpFENAHIRIDADDFTLDGFDVApg--krSKPlVMTFk--KPEEVVG 265
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   567 VDPALRRPGRFDREFYFPLPDVKAR-FKILQIQTRKWSSPLs---------------TNFIDKLAFLTKGYGGADLRSLC 630
gi 15791744  148 ERLSFIQKSAYNSEIKNQIKLYERHiKERLKKSKFYNVLADifkeynlehkeqiiflALLKEEYALSNESSISREMNSLL 227
gi 19074884   76 RDVIYLVVIVFVIAYVIYKVISSGD--RYSEQPDKGREEK------------------TESGERPSFQEGSSFENVSYFG 135
gi 7388514   319 MEQAKKEIKLIKSTTKVNLARAKMG-LPVPVTSRHTLLLGP----------------PGTGKTSVARAFTKQLCGLTVLR 381
gi 17546680  390 TRELMSLFGHEEPRGSVNGKAWVNQtLEQNPVPVIWVSNSIr---------------QIDPAYLRRFQFHLELRVPPPMV 454
gi 16263937   42 LKPVKQRIRETAALLLVERARRAMG-LSHEPPSLHMSFTGN----------------PGTGKTTVALRMANLLHRLGYIR 104
gi 9755327   143 TSHVSIKLNFHEKINLGQHIDSILDsEETNESDTYHMGSVD----------------EFIIYPFCCLEEQDELKNGSILS 206
gi 17231725  105 KDGNFINYTDWKRCDRIHRSDSVNL-LEITRVGNMVEFYINs---------------TLVDKFPADKLVDVSGKNFGFVI 168
gi 17158664  149 LGANAEIASEIVAEIPLWSQELPDT-QEIIASLISSNLFPLiy-------------tEQDYLEIANASAGLYISDIIHCL 214
gi 13472456  266 NHIAKYQSVKLAKMLMAYDFERELN-PFVELGGFLFTFIGDg--------------aPGTGKTTLIQMIAGLVNGYCQVA 330
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   631 TEAALISIQRSFpqiyrsndkllvdpskikvkvsdfmlalkkivpssarstgsspQPLPELIKPLLADQLNNLKNKLDYm 710
gi 15791744  228 SLISENDLERHKnkkllqenapll--------------------nliecdeylnaFGDISKSFFIIDEILQRIINFEPKq 287
gi 19074884  136 KEDLMIHVISQVt------------------------------------------KIVNLLRTTPEKDLHKSIETTQRN- 172
gi 7388514   382 -KPLVVETSRT--------------------------------------------KLLGRYMADAEKNTEEMLEGALG-- 414
gi 17546680  455 RESIIRKHLEGLdvsda----------------------------------fmakLAARKTLTPAQIDSAARFARLTQPa 500
gi 16263937  105 -KGHLVSVTRD--------------------------------------------DLVGQYIGHTAPKTKEILKKAMG-- 137
gi 9755327   207 TEFDKIDLELDEddg--------------------------------------feGETLNNCINSVGNFDIPLSKQTLN- 247
gi 17231725  169 HDKIKMKVHSLIvsapd---------------------------------tekesVDSHSDTRDSKQETKASFVEHDPP- 214
gi 17158664  215 TDIRKNHDLGNS----------------------------------------------SEIAKLLLAKKIQLLNRL---- 244
gi 13472456  331 GYPFAYENFGV--------------------------------------------DQISSYQGKSGQNCRQFINNVLNPr 366
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   711 lnikdttfqRNTSLLQNFIDYEEYSG----EEEEHDKYGGNEDTSSFRSYE--FFEsm--aESQICKP-------RLLIN 775
gi 15791744  288 sk----kikIESVLKDQDIFELIEPStdinDIIMPENTKELLENILKQQDKkvLERlh--sWGIKSNKni---eaKIIFY 358
gi 19074884  173 -----------FLFHGPPGTGKTLF-----MKKLIYLVDLNIKFLKMRNEM-------------GEEE----------FE 213
gi 7388514   415 ----------GAVFFDEMHTLHEKG-----YSQGDPYGNAIINTLLLYME------------NHRDEL-------VVFGA 460
gi 17546680  501 ---------MAESAESLIVRQLDHADhamgMRPEMQAHRVVTEYRLDYLNLetRFPverviEALRVRRr-----gTLCFF 566
gi 16263937  138 ----------GVLFIDEAYYLYRP-------DNERDYGQEAIEILLQVME------------NNRDDL-------VVILA 181
gi 9755327   248 ---------LVNISYLPGTTFEGQWEslyfGNNIKERLYSYATISLKIARFkqTGD-----SNQEDITtlitnnkLLLVH 313
gi 17231725  215 ---------EKDTVEAVFADLKALVG----HEQTKHQLFSLANYLKVQTER--RKRg---lKIVDTSL-------HLMLY 269
gi 17158664  245 ---------YDIEFLP--PPKVQLGG----LELMQQSFKKFKRLLTPRAKQ--YN--------LRVPK-------GIMLV 292
gi 13472456  367 --------aIGFGTIDDIDQVAARRS----DDRASAGQQEITGVLMDAFAG--AGT-----VVRGNCS-------FGMFS 420
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   776 GPKGNGQQYVGAAILN---------------YLEEFNVQNLDLa-SLVSESSRTIEAAVVQSFMEAK--------KRQPS 831
gi 15791744  359 GPAGTGKTMSALAMAK---------------SMKKSVLSFDCS--KILSKWVGESEQNVRKIFDTYKniv---qtCKQSP 418
gi 19074884  214 RMDHNEKLIRAKEMES------------------LTRITFVTPs-SLNNKYVGETEKNIRSLFQSANd------gKYWAS 268
gi 7388514   461 GYAKAMEKMLEVNQGL-----------------RRRFSTVIEFf-SYTPQELIALTQLMGRENEDVI--------TEEES 514
gi 17546680  567 GPPGTGKTVLAEHIAS---------------RLDIPLMIRRAS--DLMSKYVGETEQQIAAMFARAE---------EERA 620
gi 16263937  182 GYADRMDRFFESNPGF-----------------RSRIAHHIDFp-DYDNGELLSIAESMLSRQGYRF--------DSKAS 235
gi 9755327   314 GPPGTGKTTLCKALCQklsvrrefsdgsdtiDTNYKGIIIELScaRIFSKWFGESSKNISIVFKDIEellkvnegRGIFI 393
gi 17231725  270 GPPGTGKTTIARLVGRlykq--------mgfFPRGHVVETDRA--GIIGGYIGQTALRMESAVHQAI-----------GG 328
gi 17158664  293 GPPGTGKSHSAKACSQ---------------NMGIPLIMVDWGn-FRSF--GNQAEMKLKRLLRLAD--------RLNQV 346
gi 13472456  421 NYPENVDDALRQRAGA-----------------RWLVDGPQTRd-DYIDIFVLLAGKNHEIPLGRHE--------LYAAQ 474
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   832 VVFIPNLDIWINTIPENVILVLsglfrslqsnEKILLLCLAENLDISEVKNgilsdfafdknifqlhkpskenitryfsn 911
gi 15791744  419 ILLLNEADQFLSTRVDGSSGSD----------KMHNQMQNIFLEQIERFSG----------------------------- 459
gi 19074884  269 FVFIDEVDVFFSKRSDRSQDYT----------LKAQTEFLNTIGGACDKVN----------------------------- 309
gi 7388514   515 QVLLPSYTKFYMEQSYSEDGDLir-------gIDLLGNAGFVRNVVEKARD----------------------------- 558
gi 17546680  621 LLLLDEADSFMQSRQGAVR-------------NYEVSEVNEMLQGMERFDG----------------------------- 658
gi 16263937  236 AVMSDYIARRRRQPHFAN--------------ARSIRNALDRAR-LRQANR----------------------------- 271
gi 9755327   394 CLLIDEVEAIASSRTNLSSRNEst------dgIRVVNTLLTQLDRLKKYHN----------------------------- 438
gi 17231725  329 VLFIDEAHALAAEDTPSDFG------------KEALQILIKRMEDYRDHMA----------------------------- 367
gi 17158664  347 ILYFDDFDKGFAGDDDLAK--------------RLAGQLLTWM--QERISD----------------------------- 381
gi 13472456  475 EIQRAVEEAYEEHEKPQEDGLMkv-------yERYMKENGAPKTMADIGTY----------------------------- 518
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   912 liellktkpsdipmkkrrvkplpeLQ--KVTSNAAPTNFDEngeplsekVVLRRklksfqhqdMRLKNVLKIKLSGLMDL 989
gi 15791744  460 ------------------------VI---IATTNFLESLDS--------AFSR-----------RFDYKIEFKKPDFKDR 493
gi 19074884  310 ------------------------STvfLFGATNLYDTLDD--------AFKR-----------RFSGVYEFSPPSDEER 346
gi 7388514   559 ------------------------HR--SFRLDDEDLDAVL--------ASDLTef-----seDQLRRFKELTREDLAEG 599
gi 17546680  659 ------------------------IF---VCTTNLFDRIDE--------AALR-----------RFAFKIRFRPLERAQR 692
gi 16263937  272 ----------------------------LFEESAGPVDAE------------------------Q---LSTITARDIAAS 296
gi 9755327   439 ------------------------FL--ALATSNLLDSLDD--------AFVD-----------RADGVFYVGNPTAEGI 473
gi 17231725  368 ------------------------VV--VAGYTDEMDRLLE--------LNPGFk--------SRLNRLFYLDHYTPNQL 405
gi 17158664  382 ------------------------VL--VIASVNRMEWLPP--------ELTRA---------GRFDYLFKVDLPNNGER 418
gi 13472456  519 ------------------------LH--LIKDAEPRFTGRA--------IKNvt-------daIKMRAMDIELPDDWFEK 557
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   990 FKNRYKRFRKPPIDdaflvhlfepetsndpnwqpayiKDENMILEVSTGrkffnmdldiVEERlwngyysepkQFLKDIE 1069
gi 15791744  494 LKIWEKFLPKKALFek--------------------dFDINILSNYELSgaqi--lmvvKNTAlkvavskdgvFKIQDFI 551
gi 19074884  347 LEILEQYLGDCKK-------------------------EITSRYADLVR----------LTSG----------MVQSRIV 381
gi 7388514   600 LRAAVAEKKTK--------------------------------------------------------------------- 610
gi 17546680  693 ERMFITEALGGNADamta---------------awrdALALLDVLTPGDfatvkqqavlLGEAldpeaflaqlRQEHAIK 757
gi 16263937  297 RVFATVEPSHTETSp----------------------------------------------------------------- 311
gi 9755327   474 LHILKVCIEEMITSgiilfhar-------stgvkffnKYQDILRKIAIKcstvdisgrtIRKLplmclseyfrTFPVDDD 546
gi 17231725  406 LLIFKKFCQDNGYIldssaiivlqatfevayakrdksFGNGRFARALFEr--------sIEQQanrivthlqeLDDYEIN 477
gi 17158664  419 YSIFKLHAARFDERfrn-----------------ggdPWSEEQWRRILK----------ATNR----------CVGAEIQ 461
gi 13472456  558 PEAFMHKTYDEKKAmiee---------------lrgpFSMDMVMQEINRyadsefrysdKSDDaavekllrdaRLRERAA 622
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862  1070 LIYRDANTIGDRERVikasemfanaqmgieeistpdfiqeckatrqrdlerqelfledeekraameleakeqsqenilqe 1149
gi 15791744  552 ESIQKELNSSFDKSKivgf------------------------------------------------------------- 570
gi 19074884  382 DILKKISFSNDGSMEg---------------------------------------------------------------- 397
gi 7388514       --------------------------------------------------------------------------------
gi 17546680  758 PELRERRSMGFVPR------------------------------------------------------------------ 771
gi 16263937      --------------------------------------------------------------------------------
gi 9755327   547 EFVLALAMSARKLSAark-------------------------------------------------------------- 564
gi 17231725  478 LILAEDLSFIEFK------------------------------------------------------------------- 490
gi 17158664  462 TIVERAASTIFCETItedtys----------------------------------------------------------- 482
gi 13472456  623 REMEEMKKKGNWNA------------------------------------------------------------------ 636
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862  1150 pdlkdnkanefgvaagnqlqaqlqttintasivnnsevpqpidtnlykkeipaaipsavdkekavipedsganeeyttel 1229
gi 15791744      --------------------------------------------------------------------------------
gi 19074884      --------------------------------------------------------------------------------
gi 7388514       --------------------------------------------------------------------------------
gi 17546680      --------------------------------------------------------------------------------
gi 16263937      --------------------------------------------------------------------------------
gi 9755327       --------------------------------------------------------------------------------
gi 17231725      --------------------------------------------------------------------------------
gi 17158664      --------------------------------------------------------------------------------
gi 13472456      --------------------------------------------------------------------------------
                        890       900       910       920       930
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 1729862  1230 iqatcTSEITTDDDERARKEpkeNEDS-LQtqvteenfskidantnninhVKEIqSV 1285
gi 15791744      ---------------------------------------------------------
gi 19074884  398 ----iDWKDLRKAFEDADPKkkgTDGSdVNvves-------------lkkFYFLePK 437
gi 7388514       ---------------------------------------------------------
gi 17546680      ---------------------------------------------------------
gi 16263937      ---------------------------------------------------------
gi 9755327       ---------------------------------------------------------
gi 17231725      ---------------------------------------------------------
gi 17158664  483 esqlpALELTIEALLEERRQ---INPL-AIread------------rvesMRNKaDQ 523
gi 13472456      ---------------------------------------------------------
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap