Conserved Protein Domain Family
LAGLIDADG_1

?
pfam00961: LAGLIDADG_1 
Click on image for an interactive view with Cn3D
LAGLIDADG endonuclease
Statistics
?
PSSM-Id: 307213
View PSSM: pfam00961
Aligned: 43 rows
Threshold Bit Score: 38.7683
Threshold Setting Gi: 74607929
Created: 12-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam00961 is a member of the superfamily cl24136.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2AB5_A        20 IVGLFEGDGWITISKKGKY-------------LLYELGIEXH---IRDIQLLYKIKNILGigkvtIKKLKXKDGTikeXC 83
gi 187608888 113 LAGLIEGDGTITVQNSSSMkks---------kyrPLIVVVFK---LEDLELANYLCNLTK-----CGKVYKKINRn--YV 173
gi 74644837   93 IAGLIEGDGTIHVPKSERSnkg--------klnYPSIQIVFH---LKDLPLALLIQKELG-----HGSISRKKGLn--AY 154
gi 74607929  142 FVGLFDSNGNIQINKYKSKyl----------qFRLIIKLNNN---KENINILNNIKHYLK------GNININNN----YV 198
gi 74763642  119 LSGFFDGVGSIVINQTTLE-------------NKKQLVLTFN---QKNNQILIKIQRIVG------GNFYINTNTqsgKY 176
gi 74644827   69 WVGLMDGDGSIQVNHWRKQs------------LQYRLVIKLSn-iQSNYNMLVQIAKIIG------GTVRVTGKGg--DV 127
gi 74763643   13 WVGLMDGVGSIEVNHYRMKn------------LQYRLVLNVNd-sSENMAMLLKIQQVIG------GYLIKRKEKa--LI 71
gi 74644854  265 LLGFIEGDGSFFIRRDNLTptfsientgvqlpVLLKIKEFLEnslGFDKYSLYKIKNSSIi---lLTTVKARCVNgksSV 341
gi 386800923  31 LVGLFEGDGYFSITKKGKY-------------LTYELGIELS---IKDVQLIYKIKKILG-----IGIVSFRKRNeieMV 89
gi 386800932  44 LAGLIEGDGTIIVPNTLRSpkg--------klnYPSIQIVFH---LKDLPLALMIQKELG-----FGSLSRKKGVn--AY 105
                         90       100       110
                 ....*....|....*....|....*....|....*....
2AB5_A        84 KFNVRN-KNHLKNIIIPIFNKYPXLTNKHYDYLYFKDNL 121
gi 187608888 174 LWTIHD--LKGVYTLLNIINGY-MRTPKYEAFVRGAEFM 209
gi 74644837  155 IYTVNS--IEGVMLFINLLNGK-MKTNKIFALHKLIDWY 190
gi 74607929  199 IWIIND--IKNINNLIKLFNKYPLITINKKLQLAFIKsi 235
gi 74763642  177 KYALYFtSKEEILQLYEYFKKYPSRAYKNKRIGLIPQYY 215
gi 74644827  128 IWVVNK--KQEVEEIIKIYDTYPPLTSKKICQLAFLKTC 164
gi 74763643   72 AWTINN--KMQIEDVIKIFEDYNLVTVRKRNQLQFLKEN 108
gi 74644854  342 SLIINN-INVLYNYLIPFFSHAEFLTKKGKDFNDFKIIS 379
gi 386800923  90 ALRIRD-KNHLKSFILPIFEKYPMFSNKQYDYLRFRNAl 127
gi 386800932 106 ILTINN--KEGILFVISLLNGN-MRTPKINSLYKLIdfy 141
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap