1MLA


Conserved Protein Domain Family
FabD

?
COG0331: FabD (this model, PSSM-Id:30679 is obsolete and has been replaced by 223408)
Click on image for an interactive view with Cn3D
(acyl-carrier-protein) S-malonyltransferase [Lipid metabolism]
Statistics
?
PSSM-Id: 30679
View PSSM: COG0331
Aligned: 65 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 7-Oct-2002
Updated: 7-Oct-2002
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA           1 MTQFAFVFPGQGS-QTVGMLADMAASYP------------------------------------IVEETFAEASAALGY- 42
gi 15895289    8 SGKNAFIFQGVGI-KYQKFLTLLDESQRe-----------------------------------LLKEYCSIVYKKIKl- 50
gi 19552063   12 FKEPAILYAGQAS-AWQQVIADSSEDHIt----------------------------------aTHLRELLSRSRAKTAp 56
gi 15827605   31 GEPYVVAFGGQGS-AWLETLEELVSSAG------------------------------------LEADLATLVCEVELLl 73
gi 15827871    1 --MIALLAPGQGS-QTEGMLSPWLGLPG------------------------------------AADQIATWSKASGL-- 39
gi 19115311    1 --MSAILFPGQGV-DWKTWMQPYLENN-------------------------------------IVQNTLKEAENVTEI- 39
gi 15214000   77 IAAKEEETPGQYT-QLLRIITLEFERTFlagnevhavvh---------------slglnipaqkDVVRFYYHSCALIGQt 140
gi 15214000 1678 QPVSAYVFTGQGS-QEQGMGMDLYASSP------------------------------------VARKIWDSADKHFLTn 1720
gi 462072     69 SSLVEPSKVGQFD-QVLNLCLTEFENCYlegndihalaakllqendttlvktkeliknyitariMAKRPFDKKSNSALFr 147
gi 6324795    23 SSSYMAFFGRQGTsISISILKAIIRNKSr-----------------------------------EFQTILSQNGKESN-- 65
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA          43 -------DLWALTQ-------------------------------------------------Q---------------- 50
gi 15895289   51 -------DLWGYLTr----------------------------------------------------------------- 58
gi 19552063   57 f----arQITAIVPgs---------------------------------------------laRlee------------- 74
gi 15827605   74 e----pvAKELVVVrpigfep-----------------------------------lqwvralLaed------------- 101
gi 15827871   40 -------DLVRLGT-------------------------------------------------T---------------- 47
gi 19115311   40 -------EIRKYIVea---------------------------------------------------------------- 48
gi 15214000  141 t----kfHGSALLDessvklaaifggqgyedyfdelielyevyapfaaeliqvlskhlftlsqNeqaskvyskglnvldw 216
gi 15214000 1721 y----gfSIIDIVKhnphsitihfggskgkkirdnymamayeklmedgtskvvpvfetitkdsTsfs------------- 1783
gi 462072    148 avgegnaQLVAIFGgqgntddyfeelrdlyqtyhv-------lvgdlikfsaetlselirttlDaekvftqglnilewle 220
gi 6324795    66 -------DLLQYIFq------------------------------------------------Np--------------- 75
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA          51 -----GPAEELNKTWQTQPALLTASVALYRVWQQQG-------GKAPA----MMAGHSLGEYSALVCAG----VIDFADA 110
gi 15895289   59 -----SLSGEYDDKFSDWVSIYTIDCVVYNTYIEDG--------IKPS----VLLGYSMGLITALACGK----AISFEEG 117
gi 19552063   75 ---ltREDAQIGADIDAQPAVSIPGILLGQIAATRQlrd-lglDVAAA----SRLGHSQGILGVEAVDN-------EEDV 139
gi 15827605  102 ---lvPSDKHLTSAAVSVPGVLLTQIAVGRALARQGmd---liATPPV----GIVGHSQGVLAVEALKAggarDAELLAM 171
gi 15827871   48 -----ASTEEITDTAVAQPLIVATTLLAHQELAKHAlfe---naLDNL----IVAGHSVGEIAAYSIAG----VIAADDA 111
gi 19115311   49 ---eaKSNLRQPITTIAQPAILACSIALLRAFPPFT--------KKFR----FYVGHSLGEYSAFVASQ----TLSFSSA 109
gi 15214000  217 lagerPERDYLVSAPVSLPLVGLTQLVHFSVTAQILglnpgelASRFS----AASGHSQGIVVAAAVSAstdsASFMENA 292
gi 15214000 1784 ---ftHPSGLLSATQFTQPALTLMEKSAFEDMRSKGl------VQNDC----AFAGHSLGEYSALSAMGd---VLSIEAL 1847
gi 462072    221 npsntPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLgftpgelRSYLK----GATGHSQGLVTAVAIAEtdswESFFVSV 296
gi 6324795    76 ----sSPGSIAVCSNLFYQLYQILSNPSDPQDQAPKnmtkidsPDKKDneqcYLLGHSLGELTCLSVNS----LFSLKDL 147
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA         111 VRLVEM---RGKFMQEAVPE-------GTGAMAAIIGL-----------DDASIAKACEEAAEGQ----VVSPVNFNSP- 164
gi 15895289  118 LELLSMs--YNYPKYTSRKD---------EGMGLVTGM-----------TCSDIKKIIDKNELGd----YAYIASENNE- 170
gi 19552063  140 LAFAIL---LGAAASQFAGK--------GAHMLSVRGL-----------SREIIQDTIAGVDG-------VEVSLRNAR- 189
gi 15827605  172 AQLIGA---AGTLVARRRGIsv---lgDRPPMVSVTNA-----------DPERIRRLLDEFAQDVr--tVLPPVLSIRNg 232
gi 15827871  112 VALAAT---RGAEMAKACAI-------EPTGMSAVLGG-----------DEADVLNRLEELD--------LVPANRNAA- 161
gi 19115311  110 LKLVQA---RAKAMSYASALc-----qNPTSMLAITLTsr--------fPTDNFLNTVYSAVQKYr---LIDIANVNSD- 169
gi 15214000  293 KVALTTlfwIGVRSQQTFPTttlppsvVADSLASSEGNptpml-avrdlPIETLNKHIETTNTHLpedrKVSLSLVNGP- 370
gi 15214000 1848 VDLVFL---RGLTMQNAVHR-------DELGRSDYGMVaanpsrvsasfTDAALRFIVDHIGQQTn--lLLEIVNYNVEn 1915
gi 462072    297 RKAITVlffIGVRCYEAYPNtslppsiLEDSLENNEGVpspml-sisnlTQEQVQDYVNKTNSHLpagkQVEISLVNGA- 374
gi 6324795   148 FDIANF---RNKLMVTSTEKylvahniNRSNKFEMWALsspr----atdLPQEVQKLLNSPNLLSssqnTISVANANSV- 219
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA         165 -GQVVIAGHKEAVERAGAACKAAG-----AKRALP------------LPVSVPSHCALMK-PAADKLA------------ 213
gi 15895289  171 -YCILVSGMKNRVDKLLSIALTEG-----ALSAKD------------IDSPYAFHSKYAL-IGIEEYE------------ 219
gi 19552063  190 -AHFVVSGKPEALKKAAAALQRAAd---vYNEDINe-----------KRKGGSLAEPKFD-YLDVAIP------------ 241
gi 15827605  233 wRSVVITGTPEQLSRFERYCRQISd---kEEEDRRk-----------KIRGGDIFAPVFD-PVQVEIG------------ 285
gi 15827871  162 -GQIVAAGRLTALEKLAEDPPARA-----RVRALD--------------VAGAFHTEFMT-AALDGFA------------ 208
gi 19115311  170 -RQIVLSGDKKELESITSTLSELVrs--lGKLRSNw-----------LDVSGAFHSRYML-PARDSLKn----------a 224
gi 15214000  371 -RSFVVSGPARSLYGLNLSLRKEKadgqnQSRIPHskrklr-finrfLSISVPFHSPYLA-PVRSLLE------------ 435
gi 15214000 1916 -QQYVVSGNLLSLSTLGHVLNFLKvq--kIDFEKLk-----------ETLTIEQLKEQLT-DIVEACHaktleqqkktgr 1980
gi 462072    375 -KNLVVSGPPQSLYGLNLTLRKAKapsglDQSRIPfserklkfsnrfLPVASPFHSHLLV-PASDLINk----------d 442
gi 6324795   220 -KQCVVTGLVDDLESLRTELNLRFp----RLRITEl----------tNPYNIPFHNSTVLrPVQEPLYdy--------iw 276
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA         214 VELAKITFNAPTV-----------------------PVVNNVDVKCE--TNGDAIRDALVRQLYNPVQWTKSVEYMAAQ- 267
gi 15895289  220 KLVSRLCVCNLKI-----------------------PIISSYDQRII--VDSCELKKELVKNVWGEMKWMASVEKAINIn 274
gi 19552063  242 --FHHSSMQDAAD-----------------------LAVEWATTCG----LNVNARALAEAILVNPADWVEQIANLKAD- 291
gi 15827605  286 --FHTPHLADGIG-----------------------IVGGWAEKVG---LDVTLARELTEAILVRGVDWVREITRVHGA- 336
gi 15827871  209 EAAASITIAEPIA-----------------------MLLSNRDGKPV--ASAATGMETLISQLTHPARWDLCNVTLREH- 262
gi 19115311  225 LGETEFNISPELCytdsg--------------krflPIISNVTAELYp-ADEEDIRRQLLLQCFRPVLFKNCLKTVKSKy 289
gi 15214000  436 KDLQGLQFSALKV-----------------------PVYSTDDAGDLrfEQPSKLLLALAVMITEKVVHWEEACGFPD-- 490
gi 15214000 1981 IELERGYATIPLKidvpfhssflrggvrmfreylvkKIFPHQINVAK--LRGKYIPNLTAKPFEISKEYFQNVYDLTG-- 2056
gi 462072    443 LVKNNVSFNAKDIq---------------------iPVYDTFDGSDLrvLSGSISERIVDCIIRLPVKW-ETTTQFKAT- 499
gi 6324795   277 DILKKNGTHTLMEln--------------------hPIIANLDGNIS--YYIHHALDRFVKCSSRTVQFTMCYDTINSGt 334
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA         268 --GVEHLYEVGP--GKVLTGLTKRIVDTLTAS------------------------------------------------ 295
gi 15895289  275 ---NYNFFEVSL--IDSISRFSRMINSNCKFF------------------------------------------------ 301
gi 19552063  292 ---YVLSLDAGV--SRFTAPLLDgrgislvpafsaaerdnlarpgfhvptaedwsefapklvklpngehkvltgfsrltg 366
gi 15827605  337 --GVRWIIDLGP--GDILTRLTAPVIRglgvgivpvanrggqrtlftvgavpevvrawlsyaptvvqlpdgriklstkft 412
gi 15827871  263 --NVTAIVELPP--AGALTGIAKRELREVTTC------------------------------------------------ 290
gi 19115311  290 --GANLFYAYGP--GTTMQSIAKQNGISTKSR------------------------------------------------ 317
gi 15214000  491 ---VTHIIDFGPggISGVGSLTRANKDGQGVR------------------------------------------------ 519
gi 15214000 2057 ---SQRIKKILQnwDEYESS------------------------------------------------------------ 2073
gi 462072    500 -----HILDFGPggASGLGVLTHRNKDGTGVR------------------------------------------------ 526
gi 6324795   335 pvEIDKSICFGP--GNVIYNLIRRNCPQVDTI------------------------------------------------ 364
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA             --------------------------------------------------------------------------------
gi 15895289      --------------------------------------------------------------------------------
gi 19552063  367 yspivlagmtpttvdpeivaaaanaghwaemagggqyseevftknkeklvsllkvgrsaqfnsmffdrymwnlqfgaqri 446
gi 15827605  413 rltgrspillagmtpttvdanivaaaanaghwaelagggqvteeifanrveqlsgllepgrtyqfnalfldpylwklqvg 492
gi 15827871      --------------------------------------------------------------------------------
gi 19115311      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 462072        --------------------------------------------------------------------------------
gi 6324795       --------------------------------------------------------------------------------
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA             --------------------------------------------------------------------------------
gi 15895289      --------------------------------------------------------------------------------
gi 19552063  447 vskaratgtsingvvvsagipeveeatelindlnadgfpyvafkpgtvdqiratlkiadanpetkiiiqiedghagghhs 526
gi 15827605  493 gkrlvqkarqsgaaidgvvisggildledavelieelggigisyvvfkpgtieqirsviriatemstkpvimhveggrag 572
gi 15827871      --------------------------------------------------------------------------------
gi 19115311      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 462072        --------------------------------------------------------------------------------
gi 6324795       --------------------------------------------------------------------------------
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA             --------------------------------------------------------------------------------
gi 15895289      --------------------------------------------------------------------------------
gi 19552063  527 wvnlddlllttyaelrsrknvvvmigggigtpakaayyltgewstdlgfpampvdgilvgtaamatkeattspqvkqalv 606
gi 15827605  573 ghhswedlddlllatyselrshanitvcvgggigtpekaaeylsgrwaqaygfplmpidgilvgtaamatkeattspsvk 652
gi 15827871      --------------------------------------------------------------------------------
gi 19115311      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 462072        --------------------------------------------------------------------------------
gi 6324795       --------------------------------------------------------------------------------
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA             --------------------------------------------------------------------------------
gi 15895289      --------------------------------------------------------------------------------
gi 19552063  607 dtpgvdphdaggwvgrgdarggvtsglshlhadmyeldndsaaasrlissidsddyadhreelieainktakpffgevee 686
gi 15827605  653 rmlvetqgtdqwigsgkaqggmassrsqlgadiheidnaasrcgrlldevagdaeavaerrdeiiaamantakpyfgdvs 732
gi 15827871      --------------------------------------------------------------------------------
gi 19115311      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 462072        --------------------------------------------------------------------------------
gi 6324795       --------------------------------------------------------------------------------
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA             --------------------------------------------------------------------------------
gi 15895289      --------------------------------------------------------------------------------
gi 19552063  687 mtyaewiqrwvelayptqdptwddrfldlvhriearlneaehgaittlfpdhasveneeeavekllaaypqareiqvsar 766
gi 15827605  733 emtylqwlqryveltigegnstadtaspgspwladtwrdrfqkmlqraesrlhpsdfgliktiftdpvllekpnqaiaal 812
gi 15827871      --------------------------------------------------------------------------------
gi 19115311      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 462072        --------------------------------------------------------------------------------
gi 6324795       --------------------------------------------------------------------------------
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA             --------------------------------------------------------------------------------
gi 15895289      --------------------------------------------------------------------------------
gi 19552063  767 daawfiglcrkhhkpmpwvpaidadlarwwgldtlwqsqnerygansvrvipgpvsvagidrvdepvaellgrfeaacvd 846
gi 15827605  813 lkyypdaetvqlhpadapffvmlcqmlgkpvnfvpvidkdvrrwwrsdslwqahdarydadqvciipgiaavagitqmde 892
gi 15827871      --------------------------------------------------------------------------------
gi 19115311      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 462072        --------------------------------------------------------------------------------
gi 6324795       --------------------------------------------------------------------------------
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA             --------------------------------------------------------------------------------
gi 15895289      --------------------------------------------------------------------------------
gi 19552063  847 aldgepeeifarlnesknerefllatphivwhgnlidnpahvlnegafelieedgywviriladsyfddlpveqrpylvq 926
gi 15827605  893 pvgelldrfeqaaidevlaggaepvvvmsrrlgradvagplavvldapdvlwagriatnpvhriadpnewqvngnlsath 972
gi 15827871      --------------------------------------------------------------------------------
gi 19115311      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 462072        --------------------------------------------------------------------------------
gi 6324795       --------------------------------------------------------------------------------
                       1130      1140      1150      1160      1170      1180      1190      1200
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA             --------------------------------------------------------------------------------
gi 15895289      --------------------------------------------------------------------------------
gi 19552063  927 hvdipvelgdavatggspvvsreklpesvfallagvagvgsvsaagdeikalpeavqdgtpfgtvrdsftlpaslltaht 1006
gi 15827605  973 sstgaqlqvksedqqvvlsvpvsngwidipftlptntvdggallvstedatsamravlaivagvdgpellspvkdgtaiv 1052
gi 15827871      --------------------------------------------------------------------------------
gi 19115311      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 462072        --------------------------------------------------------------------------------
gi 6324795       --------------------------------------------------------------------------------
                       1210      1220      1230      1240      1250      1260      1270      1280
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA             --------------------------------------------------------------------------------
gi 15895289      --------------------------------------------------------------------------------
gi 19552063 1007 avtgaaleahnvgtpdvlmgacwpaiyaalgtgklsdgypviegllnavhldhlldlripleelangrtidveartdsie 1086
gi 15827605 1053 tvdwnpervadhtgvtatfreplapslatvpdalvgacwpavfsaigsavteagvlvvegllnllhldhavcvvgklptv 1132
gi 15827871      --------------------------------------------------------------------------------
gi 19115311      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 462072        --------------------------------------------------------------------------------
gi 6324795       --------------------------------------------------------------------------------
                       1290      1300      1310      1320      1330      1340      1350      1360
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA             --------------------------------------------------------------------------------
gi 15895289      --------------------------------------------------------------------------------
gi 19552063 1087 esasgrivtvrivlttegevaaklvtrfairgrittnemaapadsygardevveatprsfirqatvsapadmtpfamvsg 1166
gi 15827605 1133 paqltvtatvslaidtdmgrvvpvsvtirdttgadgavlatleerfvilgrtgtaeltgpvraggaisenatdtprrrrr 1212
gi 15827871      --------------------------------------------------------------------------------
gi 19115311      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 462072        --------------------------------------------------------------------------------
gi 6324795       --------------------------------------------------------------------------------
                       1370      1380      1390      1400      1410      1420      1430      1440
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA             --------------------------------------------------------------------------------
gi 15895289      --------------------------------------------------------------------------------
gi 19552063 1167 dynpihtsdnaaklvgldaalvhgmwlsataqhlaglgsevigwtysmygmvqlndvvditvervgraglkpayevtcri 1246
gi 15827605 1213 dvtltapidmrpfavvsgdhnpihtdrtaallaglespivhgmwlsaaaqhvvmatdgqarpaarligwtarflgmahpg 1292
gi 15827871      --------------------------------------------------------------------------------
gi 19115311      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 462072        --------------------------------------------------------------------------------
gi 6324795       --------------------------------------------------------------------------------
                       1450      1460      1470      1480      1490      1500      1510      1520
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA             --------------------------------------------------------------------------------
gi 15895289      --------------------------------------------------------------------------------
gi 19552063 1247 dgnvvsrgqallkapstayvypgqgiqakgmgqgdrtasaearavweradahtranlgfsiqqvidenptelkvgdttfv 1326
gi 15827605 1293 dkvdfrvdrigidqgaeilevsarissglvmsatarlaapktvyafpgqgiqhkgmgmdvrarskaarrvwddadkftrs 1372
gi 15827871      --------------------------------------------------------------------------------
gi 19115311      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 462072        --------------------------------------------------------------------------------
gi 6324795       --------------------------------------------------------------------------------
                       1530      1540      1550      1560      1570      1580      1590      1600
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA             --------------------------------------------------------------------------------
gi 15895289      --------------------------------------------------------------------------------
gi 19552063 1327 hpagvlnltqftqvalavvayaqterlkaanaivdgslyaghslgeytalaslgnifelegvidvvfsrgsamhslvprd 1406
gi 15827605 1373 glgfsvlhvvrdnptnitangvhyhhpdgvlyltqftqvamatvavaqvaemreqgafvegaiacghsvgeytalacvmg 1452
gi 15827871      --------------------------------------------------------------------------------
gi 19115311      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 462072        --------------------------------------------------------------------------------
gi 6324795       --------------------------------------------------------------------------------
                       1610      1620      1630      1640      1650      1660      1670      1680
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA             --------------------------------------------------------------------------------
gi 15895289      --------------------------------------------------------------------------------
gi 19552063 1407 ekgrsnyglaafrpnminvaatevenwvdrvaeesgeflqivnynvdgqqyavagtlaglkalkasasanprayvnipgi 1486
gi 15827605 1453 vyelealletvfhrgskmhdivlrdelgrsnyrlaairpsqiglpddevpafvrgiaestgefleivnfnlrgsqyaiag 1532
gi 15827871      --------------------------------------------------------------------------------
gi 19115311      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 462072        --------------------------------------------------------------------------------
gi 6324795       --------------------------------------------------------------------------------
                       1690      1700      1710      1720      1730      1740      1750      1760
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA             --------------------------------------------------------------------------------
gi 15895289      --------------------------------------------------------------------------------
gi 19552063 1487 dvpfhssvlrpgvpafaekldellpetididalrgryipnlvarpfeltqsfvdailavvpserlkgikvedtdentlar 1566
gi 15827605 1533 tvhglealeaeverrreltggrrsfilvpgidvpfhsrvlrvgvaefrrsldrvlpqdqdpdwiigryipnlvprpftla 1612
gi 15827871      --------------------------------------------------------------------------------
gi 19115311      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 462072        --------------------------------------------------------------------------------
gi 6324795       --------------------------------------------------------------------------------
                       1770      1780      1790      1800      1810      1820      1830      1840
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MLA             --------------------------------------------------------------------------------
gi 15895289      --------------------------------------------------------------------------------
gi 19552063 1567 llliellswqfaspvrwietqaliidtvdqiievglaasptltnlalrtmdvigksrpvfnverdqdtvmlndvrqapva 1646
gi 15827605 1613 rdfiqeirdlvpaeplddiladydtwrrerpsemarrvliellawqfaspvrwietqdllfteeaagglgverfveigvk 1692
gi 15827871      --------------------------------------------------------------------------------
gi 19115311      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 15214000      --------------------------------------------------------------------------------
gi 462072        --------------------------------------------------------------------------------
gi 6324795       --------------------------------------------------------------------------------
                       1850      1860      1870
                 ....*....|....*....|....*....|..
1MLA         296 -----------ALNEP-------SAMAAALEL 309
gi 15895289  302 -----------TYKSF-------MKIKNVQVQ 315
gi 19552063 1647 eveeeaveeapaaaaapaaeapvaaapvaaaa 1678
gi 15827605 1693 saptvaglatdtlklpeyshntvEVLNVERDA 1724
gi 15827871  291 -----------AVKSP-------TDLDKLANL 304
gi 19115311  318 -----------P-------------------- 318
gi 15214000  520 -----------VIVADsf---esLDMGAKFEI 537
gi 15214000      --------------------------------
gi 462072    527 -----------VIVAGtldinpdDDYGFKQEI 547
gi 6324795   365 -----------EYTSLat---idAYHKAAEEN 382
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap