Conserved Protein Domain Family
wnt

?
pfam00110: wnt 
wnt family
Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.
Statistics
?
PSSM-Id: 306592
View PSSM: pfam00110
Aligned: 196 rows
Threshold Bit Score: 264.786
Threshold Setting Gi: 675885136
Created: 11-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam00110 is a member of the superfamily cl19568.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122094185   29 ENTFFTQHQREICYNNPELLKVIVNAANIAKYECQGYFQNSRWNCSVRr-GsE-I-FYGNFDDKGNRETAYLSAINSASL 105
gi 260797592   45 KVSGFVPEQTQLCRRTLEVMPAVEYAAEAARKTCQEQFGNRRWNCSSIk---KaP-HFMNDLEKGTKEAAYVHALSSAAV 120
gi 762162828   46 KSLGMVGKQSKQCKQNLDLMGTVSHAAYVAMDTCQGQFADRRWNCSSIr-RtPk---LSRDLTRGTREQAYVYAISSASL 121
gi 241999090   47 QLHGLHARQVRLCRARLGAMPHVVEASQLAVDACQETFRDRRWNCSSVl-RaPdL-M--ADLTAGTREQAFVYALSSASL 122
gi 326924205   44 lLAGLVPDQVQICRRNLEVMHSIVQAASETKSICQKTFSGMRWNCSSIq-Ra--P-SFGPDLLKGTRESAFVHALSAAAI 119
gi 542159042   38 hcrlLVPEQLQLCRRHLEAMPSVVRAARRTQQLCQQSFADMRWNCSSIq-Ra--P-GFGPDLLTGTREAAFVHALAAAAV 113
gi 321466591   61 RQKLLTKEQVKVCLQQPATMLSVWEAGQSSSQACRQAFAERRWNCSSIdfLp----RKAPDLSHGTREQAWVYALTSAAL 136
gi 1008441087  60 RRYGLAKLQAKLCRSTMEAMPHVQKAAVLAADTCQTVFKDRRWNCSSI--T-T-ApYLTPDLTRATREQAYVYAISSAAL 135
gi 631229994   24 KYSELVSGQAKFCKRHIETMPYIISSAAAAIRTCQYTFADRRWNCSSI--N-T-ApRFTPDLTTDTREQAFVTALSSAAV 99
gi 675862788   36 NLEGLLDYQKKICIKNLDLMSGVVHASLQTAQTCQELFIDSRWNCSNI--L-Q-ApRYMPDLTGGSREQAVVYALASASL 111
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122094185  106 AWTITRYCTKGELTMCTCDHIQ-RKKHSk--wTWGGCSEDVNYGIKQARQFVD--H----QED------RS---T----- 162
gi 260797592  121 VHTVARACAAGYLKACTCARNP--GEKPdgnyTWGGCGDNVKFGLEFGSRFAD--Ap--mRKKk-----RS---H----- 181
gi 762162828  122 VHSIARACSVGVTTKCSCGALP-NHP-PhedfKWGGCGDDLKYGLYFSEQFTD--AelmkKGKi-----RK---S----- 184
gi 241999090  123 TQTWARACGQGRLTGCGCGRAP-REP-PqgdfKWGGCADNVRFGARLARAFTD--A----PWKr-----AP---Pdt--- 183
gi 326924205  120 AHSIAQACASGSLPLCSCG-SV-PSELPgpdfRWGGCGDNLHYGLQLGAAFAD--S----PLKs-----SMlglQ----- 181
gi 542159042  114 AQSIARSCASGELPRCSCGPAP-AEPPApa-sRWGGCGDNLSHGLQLGAAFTDgsA----RAAa-----AP---G----- 174
gi 321466591  137 TRAVARGCSSGILKQCACGSFP-RHPPDgq-fKWGGCGDDIKYAKQFAKSFTD--A----SLKrh--wkKP---H----- 198
gi 1008441087 136 TYTMARACASGTLYHCTCAGKP-DEPPNsn-fQWGGCGDNIHWGVYFAKRFID--N----VEKnnvdksRK---Rrkgye 204
gi 631229994  100 VNTISIACSSGLLASCGCAPVP-QEPAYgd-fKWGGCGDDIKYGLRISKSFTD--A----PWRgk--kkKG---T----- 161
gi 675862788  112 VQSIAKTCSSGYSTKCSCGRHPfDEPPAtd-fKWGGCGDDVRFSVDFSHKFTD--K----FWQkklkekKL---K----- 176
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122094185  163 ------------SFGLMNLHNNEAARRTLRAKMQKVCKCHGMSGSCTTRVCWRRLPPMKLMADTLGSMFDAaAlVK-P-- 227
gi 260797592  182 ------------TQTLMNLHNSEAGRLAVQNTMTTKCKCHGVSGSCNVKTCWKSLADLTEISHELAEKYSY-A-IK-V-- 244
gi 762162828  185 ------------KKSQMNSHNNAVGRLMVAKSMTTACKCHGVSGSCSVKTCWRSLPDFSVIGTTLKNLYAN-A-VE-Vqr 249
gi 241999090  184 -----------aFRALLNRHNYKAGRQAVHESLTTLCKCHGVSGACNIKTCWRGLSSLRHVSQRLRRRYQV-A-VE-V-- 247
gi 326924205  182 ------------ALRAMNWHNNVAGRQVLSESLDTKCKCHGVSGSCSVKTCWKALPSLGEIASELKSKYLA-A-IR-V-- 244
gi 542159042  175 ------------LRA-VNRHNGAVGRAVLSDSLDTRCKCHGVSGSCSVKTCWKGLPDLGEIASDLKSRYLA-A-LK-V-- 236
gi 321466591  199 ------------VISAVNMHNNRVGRKVAEQSLQTQCKCHGVSGSCQIKTCWRSLPPIGEIASRMKMLYGL-A-VEvT-- 262
gi 1008441087 205 ydedrksklvreEIAAVNLHNNRVGRRIIRESIQTQCKCHGVSGSCNVKTCWKGLPPMFEIGRKLMKQYTN-A-KE---- 278
gi 631229994  162 ------------LRAAVNRHNSDAGRQIIHDNLRTQCKCHGVSGSCNVRTCWRALPSMEQVAMRLKTSYAV-A-VE-V-- 224
gi 675862788  177 ------------KLAMINLHNNRVGRQIMSTSLGTSCKCHGVSGSCSVKTCWKSLPDLKTIGALLVHQYAI-A-VEvDlr 242
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122094185      --------------------------------------------------------------------------------
gi 260797592      --------------------------------------------------------------------------------
gi 762162828      --------------------------------------------------------------------------------
gi 241999090      --------------------------------------------------------------------------------
gi 326924205      --------------------------------------------------------------------------------
gi 542159042      --------------------------------------------------------------------------------
gi 321466591      --------------------------------------------------------------------------------
gi 1008441087     --------------------------------------------------------------------------------
gi 631229994      --------------------------------------------------------------------------------
gi 675862788  243 rprvknddvtvggkrggrsgdkqqqqmsnsfwldheekwidfdyggeealimamnnnnnnnnnnnqnginninannnnnn 322
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122094185  228 --------------------------------------------VEN-------K-GviK--K--LKRkdSQY--KKVNK 249
gi 260797592  245 --------------------------------------------VKR-------KiG--T--RqqLVP--EDRrsRRHGS 267
gi 762162828  250 -------------------------------------------kKRK-------N-K--R--L--FVP--LRSnvQSVSK 270
gi 241999090  248 --------------------------------------------ARHapagvggS-P--H--K--IVP--VSDhvGRLQK 274
gi 326924205  245 --------------------------------------------SHRlv----gH-R--K--Q--LKP--TETdiRVMRD 267
gi 542159042  237 --------------------------------------------THRlv----gP-R--K--Q--LIP--KEGdaRPVTE 259
gi 321466591  263 --------------------------------------------PRR-------P-Nd-------MRRr-SAVa-SGRLA 281
gi 1008441087 279 --------------------------------------------VSR-------Y----------YVE--GNL--GKTRI 293
gi 631229994  225 --------------------------------------------VNK-------K----PatKmqLLP--AMHr-GKIED 246
gi 675862788  323 hmnndyneydygvdvrvmkaksappsppslsnkknnknnknknnKNK-------K-D--V--KkvLVPi-LPFr-KNFSE 388
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122094185  250 SD-LVYIADSPDYCEENESLGIFGTRGRFCNRTSYGIEG-CRLLCCGRGYQTRIRNVEEKCNCKFVWCCSVKCDTCNVRK 327
gi 260797592  268 GD-LIFVENSPNYCMVNNRKGSYGTTGRLCNKTSVGPDS-CQTMCCGRGYNDFTVTVTERCNCKYHWCCYVTCDQCTRTE 345
gi 762162828  271 ES-LIYFTKSPDYCSPDPKTGSVGTQERFCSSESSGWGG-CDAMCCGRGYRSFTKKIVERCECKYYWCCYVKCKTCEKTL 348
gi 241999090  275 AD-LVYRTKSPDYCSWDTRVGSLGTEGRTCNSTESGTLG-CDSMCCGRGYITLRKQVSERCHCRYHWCCFVECKTCSDWT 352
gi 326924205  268 TD-LVYLINSPDYCTPNVHLGSVGTQDRQCSKTSAGSDG-CDLLCCGRGYNAYMEEVVERCHCKYRWCCYVVCKRCRRLE 345
gi 542159042  260 MD-LVYLISSPDYCTPNPQLGSLGTQDRPCNRSSVGSDS-CDLLCCGRGYNTYTEEVQERCHCRYRWCCSVVCRRCRRSL 337
gi 321466591  282 QD-LIYITKSPDFCRPDKQSGSLGTAGRMCNATHESSSGsCASLCCGRGYITVIREQVERCNCKYIWCCTVRCKTCRRQV 360
gi 1008441087 294 SDhLLYLSKSPDYCTKDVKLGSFGTVGRKCNVTTNETNS-CRQLCCGRGYRTLVEEKLERCHCKYYNCCYVKCKICRTKT 372
gi 631229994  247 MD-LVYITKSPDYCSRDPRFGSVGTKGRRCNTTSEDHDS-CDSMCCGRGFRTFSIEIKSRCRCKYVWCCFVKCKICSSIQ 324
gi 675862788  389 ND-LLFITKSPDYCLPEPSLGSIGTKGRECSRTEDGSGG-CKSMCCGRGFTSEEVEIQYRCDCKYYWCCYVKCKTCYKVV 466

                  ....*
gi 122094185  328 DEYIC 332
gi 260797592  346 KKYMC 350
gi 762162828  349 HLNVC 353
gi 241999090  353 LVDVC 357
gi 326924205  346 ERYVC 350
gi 542159042  338 DRHVC 342
gi 321466591  361 EVHMC 365
gi 1008441087 373 QIYEC 377
gi 631229994  325 Q---- 325
gi 675862788  467 EINRC 471
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap