3N9Y,3MZS,3SN5,4NKZ,3GPH


Conserved Protein Domain Family
p450

?
pfam00067: p450 (this model, PSSM-Id:306555 is obsolete and has been replaced by 395020)
Click on image for an interactive view with Cn3D
Cytochrome P450
Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.
Statistics
?
PSSM-Id: 306555
View PSSM: pfam00067
Aligned: 50 rows
Threshold Bit Score: 248.732
Threshold Setting Gi: 117304
Created: 11-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3N9Y_A  12 PSPGDNGWLNLYHFWReTg---THKVHLHHVQNFQKY--GPIYREKLGNVESVYVIDPEDVALLFKSEGpnpERflIPPW 86  human
P28649  48 PGPG---YCLGIGPLIsHgrflWMGIGSACNYYNKMY--GEFMRVWISGEETLIISKSSSMFHVMKHSHy-iSRf-GSKR 120 house mouse
P13584  47 PGPP-THWLFGHALEIq----eTGSLDKVVSWAHQFP--YAHPLWFGQFIGFLNIYEPDYAKAVYSRGd--pKAp-D--- 113 human
P08516  52 PSPP-FHWFFGHKQFQg-----DKELQQIMTCVENFP--SAFPRWFWGSKAYLIVYDPDYMKVILGRSd--pKAngVYRL 121 Norway rat
P20816  52 PSTP-SHWLWGHNLK-------DREFQQVLTWVEKFP--GACLQWLSGSTARVLLYDPDYVKVVLGRSd--pKP------ 113 Norway rat
P11707  37 PGPT-PLPFIGTILEYrKg------IWDFDIECRKKY--GKMWGLFDGRQPLMVITDPDMIKTVLVKECy-sVFt-NRRS 105 rabbit
P04800  39 PGPK-PLPFFGTVLNYyMg------LWKFDVECHKKY--GKIWGLFDGQMPLFAITDTEMIKNVLVKECf-sVFt-NRRD 107 Norway rat
Q04552  31 VAGPKPVPFFGNLKDSvLr---RKPQVMVYKSIYDEFpnEKVVGIYRMTTPSVLLRDLDIIKHVLIKDFesfADrgVEFS 107 black swallowtail
P33270  32 PHDA-PHPLYGNMVGFrKnrvmHDFFYDYYNKYRKSG--FPFVGFYFLHKPAAFIVDTQLAKNILIKDf--sNFa-DRGQ 105 fruit fly
P13527  35 PHEE-PHLVMGNVKGLrSkyhiGEIIADYYRKFKGS---DPLPGIFLGHKPAAVVLDKELRKRVLIKDf--sNFa-NRGL 107 house fly
3N9Y_A  87 VAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPeATknFLPLLDAVSRDFVSVLHRRIKKAGsgnySGDISDDLFRFA 166 human
P28649 121 GLQCIGMHENGIIFNNNPSLWRTIRPFFMKALTGP-GLvrMVEVCVESIKQHLDRLGEVTDTSG----YVDVLTLMRHIM 195 house mouse
P13584 114 VYDFFLQWIGRGLLVLEGPKWLQHRKLLTPGFHYD-VLkpYVAVFTESTRIMLDKWEEKAREGK----SFDIFCDVGHMA 188 human
P08516 122 LA----PWIGYGLLLLNGQPWFQHRRMLTPAFHYD-ILkpYVKNMADSIRLMLDKWEQLAGQDS----SIEIFQHISLMT 192 Norway rat
P20816 114 -YQSLAPWIGYGLLLLNGKKWFQHRRMLTPAFHYD-ILkpYVKIMADSVSIMLDKWEKLDDQDH----PLEIFHYVSLMT 187 Norway rat
P11707 106 FG--PVGFMKKAVSISEDEDWKRVRTLLSPTFTSG-KLkeMLPIIAQYGDVLVKNLRQEAEKGK----PVDLKEIFGAYS 178 rabbit
P04800 108 FG--PVGIMGKAVSVAKDEEWKRYRALLSPTFTSG-RLkeMFPIIEQYGDILVKYLKQEAETGK----PVTMKKVFGAYS 180 Norway rat
Q04552 108 LDG-----LGANIFHADGDRWRSLRNRFTPLFTSG-KLksMLPLMSQVGDRFINSIDEVSQTQP----EQSIHNLVQKFT 177 black swallowtail
P33270 106 FHNGRDDPLTQHLFNLDGKKWKDMRQRLTPTFTSG-KMkfMFPTVIKVSEEFVKVITEQVPAAQng-aVLEIKELMARFT 183 fruit fly
P13527 108 YYNEKDDPLTGHLVMVEGEKWRSLRTKLSPTFTAG-KMkyMYNTVLEVGQRLLEVMYEKLEVSS----ELDMRDILARFN 182 house fly
3N9Y_A 167 FESITNVIFGERQGmLEEVVNPEAQRFIDAIYQMFhTSVPMLNLPPDl-FRLFRTKTWKDHVAAWDVIFSKADIYTQNFY 245 human
P28649 196 LDTSNMLFLGIP---LDES-A--IVKKIQGY-----FNAWQALLIKPn-IFFKISWLYRKYERSVKDLKDEIAVLVEKKR 263 house mouse
P13584 189 LNTLMKCTFGR-GDtGLGHRDSSYYLAVSDLTLLM-QQRLVSFQYHNd-FIYWLTPHGRRFLRACQVAHDHTDQVIRERK 265 human
P08516 193 LDTVMKCAFSHNGSvQVDGNYKSYIQAIGNLNDLF-HSRVRNIFHQNd-TIYNFSSNGHLFNRACQLAHDHTDGVIKLRK 270 Norway rat
P20816 188 LDTVMKCAFSHQGSvQLDVNSRSYTKAVEDLNNLI-FFRVRSAFYGNs-IIYNMSSDGRLSRRACQIAHEHTDGVIKTRK 265 Norway rat
P11707 179 MDVITGTSFGVNIDsLRNPQD-PFVKNVRRL--LK-FSFFDPLLLSIt-LFPFLTPIFEALH-ISMFPKDVMDFLKTSVE 252 rabbit
P04800 181 MDVITSTSFGVNVDsLNNPKD-PFVEKTKKL--LR-FDFFDPLFLSVv-LFPFLTPIYEMLN-ICMFPKDSIEFFKKFVY 254 Norway rat
Q04552 178 MTNIAACVFGLN---LDEGMLKTLEDLDKHIFTVN--YSAELDMMYPgiLKKLNGSLFPKVVSK--FFDNLTKNVLEMRK 250 black swallowtail
P33270 184 TDVIGTCAFGIECNtLRTPVS-DFRTMGQKV--FT-DMRHGKLLTMFv-FS--FPKLASRLR-MRMMPEDVHQFFMRLVN 255 fruit fly
P13527 183 TDVIGSVAFGIECNsLRNPHD-RFLAMGRKS--IE-VPRHNALIMAFi-DS--FPELSRKLG-MRVLPEDVHQFFMSSIK 254 house fly
3N9Y_A 246 WELRQKg-----sVHHDYRGILYRLLGd---------------sKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARN 305 human
P28649 264 HKVSTAe-----kLEDCMDFATDLIFAerr-------------gdLTKENVNQCILEMLIAAPDTMSVTLYFMLLLVAEY 325 house mouse
P13584 266 AALQDEkvrkkiqNRRHLDFLDILLGArde-----------ddiKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALY 334 human
P08516 271 DQLQNAgelekvkKKRRLDFLDILLLArme-----------ngdSLSDKDLRAEVDTFMFEGHDTTASGVSWIFYALATH 339 Norway rat
P20816 266 AQLQNEeelqkarKKRHLDFLDILLFAkme-----------dgkSLSDEDLRAEVDTFMFEGHDTTASGISWVFYALATH 334 Norway rat
P11707 253 KIKDDRlk---dkQKRRVDFLQLMINSqnske-------idshkALDDIEVVAQSIIILFAGYETTSSTLSFIMHLLATH 322 rabbit
P04800 255 RMKETRld---svQKHRVDFLQLMMNAhndskd------keshtALSDMEITAQSIIFIFAGYEPTSSTLSFVLHSLATH 325 Norway rat
Q04552 251 GTPSYQ-------K-DMIDLIQELREKktlelsrkhenedvkalELTDGVISAQMFIFYMAGYETSATTMTYLFYELAKN 322 black swallowtail
P33270 256 DTIALRer---enFK-RNDFMNLLIELkqkgrvtl--dngevieGMDIGELAAQVFVFYVAGFETSSSTMSYCLYELAQN 329 fruit fly
P13527 255 ETVDYRek---nnIR-RNDFLDLVLDLknnpes------isklgGLTFNELAAQVFVFFLGGFETSSSTMGFALYELAQN 324 house fly
3N9Y_A 306 LKVQDMLRAEVLAAR-HQa--qGDMATMLQLVPLLKASIKETLRLHPISV--TLQRYLVNDLVLRD---YMIPAKTLVQV 377 human
P28649 326 PEVEAAILKEIHTVV-GDr---DIKIEDIQNLKVVENFINESMRYQPVVD--LVMRRALEDDVIDG---YPVKKGTNIIL 396 house mouse
P13584 335 PEHQHRCREEVREIL-GDq--dFFQWDDLGKMTYLTMCIKESFRLYPPVP--QVYRQLSKPVTFVDg--RSLPAGSLISM 407 human
P08516 340 PEHQQRCREEVQSVL-GDg--sSITWDHLDQIPYTTMCIKEALRLYPPVP--GIVRELSTSVTFPDg--RSLPKGIQVTL 412 Norway rat
P20816 335 PEHQERCREEVQSIL-GDg--tSVTWDHLDQMPYTTMCIKEALRLYSPVP--SVSRELSSPVTFPDg--RSIPKGIRVTI 407 Norway rat
P11707 323 PDVQQKLQEEIDTLL-PNk--eLATYDTLVKMEYLDMVVNETLRLYPIAG--RLERVCKKDVDING---TFIPKGTIVMM 394 rabbit
P04800 326 PDTQKKLQEEIDRAL-PNk--aPPTYDTVMEMEYLDMVLNETLRLYPIGN--RLERVCKKDVEING---VFMPKGSVVMI 397 Norway rat
Q04552 323 PDIQDKLIAEIDEVLsRHd--gNITYECLSEMTYLSKVFDETLRKYPVAD--FTQRNAKTDYVFPGt-dITIKKGQTIIV 397 black swallowtail
P33270 330 QDIQDRLRNEIQTVL-EEqe-gQLTYESIKAMTYLNQVISETLRLYTLVP--HLERKALNDYVVPGhekLVIEKGTQVII 405 fruit fly
P13527 325 QQLQDRLREEVNEVF-DQfkedNISYDALMNIPYLDQVLNETLRKYPVGVgsALTRQTLNDYVVPHnpkYVLPKGTLVFI 403 house fly
3N9Y_A 378 AIYALGREPTFFFDPENFDPTRWLSKDKN-ITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTT 456 human
P28649 397 NIGRMHR-LEYFPKPNEFTLENFEKN----VPYRYFQPFGFGPRGCAGKYIAMVMMKVVLVTLLRRFQVKTLQKRCIENI 471 house mouse
P13584 408 HIYALHRNSAVWPDPEVFDSLRFSTENASkRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDP-SRLPIK 486 human
P08516 413 SIYGLHHNPKVWPNPEVFDPSRFAPD--SpRHSHSFLPFSGGARNCIGKQFAMSEMKVIVALTLLRFELLPDP-TKVPIP 489 Norway rat
P20816 408 LIYGLHHNPSYWPNPKVFDPSRFSPD--SpRHSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDP-TRIPVP 484 Norway rat
P11707 395 PTYALHRDPQHWTEPDEFRPERFSKKNKDnINPYIYHPFGAGPRNCLGMRFALMNIKLALVRLMQNFSFKLCKETQVPLK 474 rabbit
P04800 398 PSYALHRDPQHWPEPEEFRPERFSKENKGsIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQIPLK 477 Norway rat
Q04552 398 STWGIQNDPKYYPNPEKFDPERFNPENVKdRHPCAYLPFSAGPRNCLGMRFAKWQSEVCIMKVLSKYRVEPSMKSSGPFK 477 black swallowtail
P33270 406 PACAYHRDEDLYPNPETFDPERFSPEKVAaRESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVCDTTEIPLK 485 fruit fly
P13527 404 PVLGIHYDPELYPNPEEFDPERFSPEMVKqRDSVDWLGFGDGPRNCIGMRFGKMQSRLGLALVIRHFRFTVCSRTDIPMQ 483 house fly
3N9Y_A 457 FNL---ILMPEKPISFTF 471 human
P28649 472 PKKn-dLSLHPNEDRHLV 488 house mouse
P13584 487 MPQ---LVLRSKNGFHLH 501 human
P08516 490 LPR---LVLKSKNGIYLY 504 Norway rat
P20816 485 MPR---LVLKSKNGIHLR 499 Norway rat
P11707 475 LGKq-gLLQPEKPIVLKV 491 rabbit
P04800 478 LSRq-gLLQPTKPIILKV 494 Norway rat
Q04552 478 FDPmrlFALPKGGIYVNL 495 black swallowtail
P33270 486 YSPm-sIVLGTVGGIYLR 502 fruit fly
P13527 484 INPe-sLAWTPKNNLYLN 500 house fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap