Conserved Protein Domain Family
zf-C2H2_aberr

?
pfam17017: zf-C2H2_aberr (this model, PSSM-Id:293622 is obsolete and has been replaced by 319080)
Aberrant zinc-finger
This is a family of largely microsporidia-specific proteins with an aberrant zinc-finger motif of Cx(4)C2H repeated.
Statistics
?
PSSM-Id: 293622
View PSSM: pfam17017
Aligned: 8 rows
Threshold Bit Score: 159.59
Threshold Setting Gi: 484853369
Created: 16-Jul-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EPR79294      20 YKCFYKDCHLMYSTIYALRKHVVTYKHSNYFDNEvFSLKCPYRECCEvyihnnffpNFEIKNLVFPHLKRKHSmvkediY 99  Spraguea lophii...
ELQ74248      17 YKCLHNSCDLFYDSVLGLRRHISHYDHNLYYNPG-YSLKCPVRKCSVsi------vKLDNVEFLYDHFEKEHA------Q 83  Trachipleistoph...
EHY65114      25 FKCPYSACGLQYQSSLGYKRHLMYYKHSIFTPSN-KKIVCGYMDC-------------TATENLREHITREHM------A 84  Nematocida sp. ...
KFG27253      25 FKCPYSACGLQYQSSLGYKRHLMYYKHSIFTPSN-KKIVCGYMDC-------------TATENLREHITREHM------A 84  Nematocida sp. ...
XP_008073791  17 YKCLHSRCDLFYDSVLGLRRHISHYDHNLYYNAG-YSLKCPVRKCDMsi------cELDNTDFLYSHFEKEHA------P 83  Vavraia culicis...
EIJ88525      25 FKCPYIACGLQYQSSLGYKRHLMYYKHSIFTPSS-KKIVCGYMDC-------------TATENLRDHITREHM------A 84  Nematocida pari...
EJW03468      15 LKCIYNDCSCKFESEENLFNHLGLYEHIFFGKDK-RGFNCVFEPCKY---------ITHSTNKLLIHVSQCRMdgtemiS 84  Edhazardia aedi...
EOB11890       3 YKCPFVNCNVKNSKTDFMDEHFREAEH--YTND--FELKCPIEKCK-------------NLNNCELHFEKRYA------- 58  Nosema bombycis...
EPR79294     100 NILEAVYECVIEYKNNGNKLKVKSRnkevVHKKEDVIINMEDM-QNDNGVLKNIFSTIFFNSVIYIGDIRNK----NLFY 174 Spraguea lophii...
ELQ74248      84 RLAAQLRDILVRIKKTYETTKINYL----EHNVSDNCVNLSAV-MRENDLLKDVLCSVYPSGVIKINDIDKP----DLIF 154 Trachipleistoph...
EHY65114      85 DAAELLEAYEIMIKVGEETEEVSTAgligDIVHDEGLLDISKV-MTEDGIVKEILLSIFPKGVTHIIDMDTFsesnQIFY 163 Nematocida sp. ...
KFG27253      85 DAAELLEAYEIMIKVGEETEEVSTAgligDIVHDEGLLDISKV-MTEDGIVKEILLSIFPKGVTHIIDMDTFsesnQIFY 163 Nematocida sp. ...
XP_008073791  84 RLVAQLKDTLVRIKKTYETTNINYL----ELNASDNCVNLSIV-MRENDLLKDVMCFVYPNGVMKINDIDKP----DLIF 154 Vavraia culicis...
EIJ88525      85 DAVDLLEAYDIMIKVGEETEEVSTAgligDIVHDEGLLDISKV-IAEGGILKDILLSIFPKGVTLIIDPETFtesnQIFY 163 Nematocida pari...
EJW03468      85 DLAILHR--LIKDSLKNETFDSENA------KTDEENAKLCLFdLFKNKSFGYIFEYLFPNGILSVRQQKQQk--kMIFT 154 Edhazardia aedi...
EOB11890      59 KFLRYVKFQEIAIENFNR----NYK----ESV-------FDDL-ITSRDTIATIIKTFIVNGKRGTYDSKNR------IS 116 Nosema bombycis...
EPR79294     175 CRLNGCGKSFNSLTAYKYHCFNFYHSLKHIFLKY 208 Spraguea lophii 42_110
ELQ74248     155 CGIPGCGKHFKSVMAYKYHCQTYLHSFATLFDSY 188 Trachipleistophora hominis
EHY65114     164 CRIPGCGRQFKSLMAYKYHCGKFTHLFKSIIDDY 197 Nematocida sp. 1 ERTm2
KFG27253     164 CRIPGCGRQFKSLMAYKYHCGKFTHLFKSIIDDY 197 Nematocida sp. 1 ERTm6
XP_008073791 155 CGIPGCGKHFKSVMAYKYHCQTYLHSFITLFDSY 188 Vavraia culicis subsp. floridensis
EIJ88525     164 CRIPGCGRQFKSLMAYKYHCGKFTHFFKSIIDDY 197 Nematocida parisii ERTm3
EJW03468     155 CKIPICSEVFENRDSLIEHIKTYKHDLSRLDKSV 188 Edhazardia aedis USNM 41457
EOB11890     117 CPVIGCNKRYKQFPGYVYHTKNYKHPISEMISEY 150 Nosema bombycis CQ1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap