4LCT


Conserved Protein Domain Family
RPN7

?
pfam10602: RPN7 (this model, PSSM-Id:287560 is obsolete and has been replaced by 431387)
Click on image for an interactive view with Cn3D
26S proteasome subunit RPN7
RPN7 (known as the non ATPase regulatory subunit 6 in higher eukaryotes) is one of the lid subunits of the 26S proteasome and has been shown in Saccharomyces cerevisiae to be required for structural integrity. The 26S proteasome is is involved in the ATP-dependent degradation of ubiquitinated proteins.
Statistics
?
PSSM-Id: 287560
Aligned: 59 rows
Threshold Bit Score: 118.066
Threshold Setting Gi: 159107706
Created: 27-Jun-2015
Updated: 5-Aug-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4LCT_B        73 DLAWCEAVDRRAEQKKVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFKNYIR-TRDYCTTTKHIIHMCMNA 151 thale cress
O94308        77 DVEWVESVTFHRKQNLEQLRRELKAYKNNLIRESIRAAQLDLASFFADVGQFDSALRSYAK-VREYCTNAGQIAHLSLEL 155 Schizosaccharom...
Q2HA08        86 DQDWLQAREEENKVETNRLLKELKGYKNNLIKESIRMGNEDLAKHLESIGDLNAASETFSK-MRPDVSTAKQLIDVSKHL 164 Chaetomium glob...
Q7RXQ1        80 DKAWMESKEKENRDTTAHLQAELQGYKNNLIKESIRMGNEDLGKHFEAIGDVEAAMDSFWK-MRTEVSSTEQLVDLGKLL 158 Neurospora cras...
Q9VJR9       105 DSYWVEDNIMEATLMLQELDAELNFKKSNSGSSYVRRILEEIGDHHEKSGNLQMAVKFYAR-ARPYCTSSENVINMFRNL 183 fruit fly
Q9GS00       163 DQKWIEENGATWQSTTDQLQAEYKRHKDEGVKESTRRAMEDLFQHYMMAGKIDEAIRLYSRgIRDYCTQLKHSINMWINW 242 Caenorhabditis ...
XP_002638604 160 DTKWVDETSGSWQVALDHLQIEYKRHKDEGVKESTRRAMEDLFRHFLVAGKTEEAIRLYSRgIRDYCTQLKHSINMWMNW 239 Caenorhabditis ...
XP_001586570  80 DDQWIDATNKSNAAEAARLEAQLKGYKNNLIKESTRMGNEDLGKHYEATGQLALAFDAYSR-MRQDISIPRHVIDVCKHI 158 Sclerotinia scl...
XP_001542604  41 KVVRVE-------AKGFILVQSRQSSIWSPISAIIKMGNEDLGHHYHLIGDLPSASKAYSR-MREYCTTTSHIGSMLFRN 112 Ajellomyces cap...
XP_001276598 120 DTKWVDHMQKVVKAETDRLEHELRGYKNNLIKESIRMGNEDLGQHYHQIGNLVAASKAYSR-MRDYCTTPSHIASMLFKI 198 Aspergillus cla...
4LCT_B       152 ILVSIEMGQFTHVTSYVNKAEQNPETLE-----------------------------------------PMVNAKLRCAS 190 thale cress
O94308       156 MRISIWIGNYSHVLAFGSRAKSTVSAA------------------------------------------MELTSPIYAYC 193 Schizosaccharom...
Q2HA08       165 VRVCIQRREWDMVSAHLSKIGGAQSADEe----------------------------------------KAVQPYLKIAY 204 Chaetomium glob...
Q7RXQ1       159 VRVAIERRDWKSIGNHLKPLNSVNDSDPk---------------------------------------aKALKTYSKIAN 199 Neurospora cras...
Q9VJR9       184 IRVSIYMENWWHVLTYIDEAKQYAYGFEnl--------------------------------------aQEVPARLSCVA 225 fruit fly
Q9GS00       243 MEVAICANDWGKLDTVTNTAYRSLKDADdaeknsqqsqqappqrgenapymverdpnapiqtltnrqliETALAKCLAAQ 322 Caenorhabditis ...
XP_002638604 240 IEVSICGNDWGKLESITSTAFRSLKDADdaeknnqqqqrgenaty-------lvnqsapmtspsnrqliETALAKCQAAQ 312 Caenorhabditis ...
XP_001586570 159 IEVSIERKEYIAVLSNVQKMRGTSVGPYd---------------------------------------dQDVKPFCHVAE 199 Sclerotinia scl...
XP_001542604 113 IHVAIDRGDWLGVQSNVQRLRNLQFKPEd---------------------------------------eAKNKAKMFAAL 153 Ajellomyces cap...
XP_001276598 199 INVAIERGDWLSVQSNVHRLRNLQSKPEe---------------------------------------qAKNQPKMSAAL 239 Aspergillus cla...
4LCT_B       191 GLAHLELKKYKLAARKFLDVNPELGns-yNEVIAPQDIATYGGLCALASFDRSELKQK 247 thale cress
O94308       194 GLANFCLGDYEEALAHFLKVETDTS----DGIITKTDISVYISLCALACWDHKRLIQE 247 Schizosaccharomyces pombe 972h-
Q2HA08       205 GIAFLGRGRFKDAALSFLSADSSIPsstyGELASQSDVAIYGGLLALASMDRAELQST 262 Chaetomium globosum CBS 148.51
Q7RXQ1       200 GIAALGQERYKEAAFCFVEASSGVPpeiyNQIASPNDVAIYGGLLALATMDRHELQAN 257 Neurospora crassa OR74A
Q9VJR9       226 GLAHLGLKIYKSAAQYFLSTPYGRyd--yDKIVAPEDVTLYAGLCALATFDRETLQLN 281 fruit fly
Q9GS00       323 VLLKLRNKRYSQVVETILQIKTEClq--sKWFVTSSDLGIYGMLSAMATMSRADLKLQ 378 Caenorhabditis elegans
XP_002638604 313 VILKLRNHRYSDVLETVLVIKTECld--sKWYVTSSDLGIYSVLCAMATLGRTNLKKL 368 Caenorhabditis briggsae
XP_001586570 200 GIAQMHAGQYAMAAQTFLQVPPGFAgs-yYTIVTANDVAVYGGLCALATIERNDLQKL 256 Sclerotinia sclerotiorum 1980 UF-70
XP_001542604 154 GLSQLASSAYHSAAINFLSTDPILAdn-yKEVISANDIAVYGGLCALASMDRADLQTH 210 Ajellomyces capsulatus NAm1
XP_001276598 240 GLSQLHSGSYLEAANCFLSTDPSLGds-yNEVLTSNDVAVYGGLCALASMDRNELQRR 296 Aspergillus clavatus NRRL 1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap