Conserved Protein Domain Family
TMEM189_B_dmain

?
pfam10520: TMEM189_B_dmain (this model, PSSM-Id:287490 is obsolete and has been replaced by 431335)
B domain of TMEM189, localization domain
TMEM189_B is the B domain or probable localization domain of the transmembrane protein TMEM189 which in some mammals is fused with Kua ubiquitin-conjugation E2 enzyme proteins. The domain is also found on fatty acid saturase FAD4 in Arabidopsis.
Statistics
?
PSSM-Id: 287490
Aligned: 57 rows
Threshold Bit Score: 183.959
Threshold Setting Gi: 242082498
Created: 27-Jun-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4QCH1        81 MMLADLVSGLVHWGMDTWGTPDTPIFGTFIRSFREHHVDQTAMCKHDFIEtNADT--------TLPLLPLLLIqyacvrs 152 Leishmania major
XP_003530742 125 YILADLGSGVYHWAIDNYGDGSTPIVGaQIEAFQGHHKWPWTITRRQFAN-NLHAlaravtlaVLPVVLLC--------- 194 soybean
XP_006346230 144 YIVSDLASGIYHWGIDNYGSAKTPVFGaQIDAFQGHHKWPWTITRREFSN-NLHSlaravtftVLPIDLFC--------- 213 potato
XP_009420217 102 YILADLGTGIYHWAIDNYGGPSTPVFGSQIEAFQGHHRWPWTITRRQFAN-NLHAlarsvalaVLPIEALLya------- 173 wild Malaysian ...
XP_002888037 102 YVLADLGSGVYHWAIDNYGDKSTPLVGaQLEASQGHHKWPWTITKRQFAN-NSHTiaraitftVLPLNLVI--------- 171 Arabidopsis lyr...
XP_006858154 122 YFVADLATGIYHWAIDNYGDASTPVFGSQIDAFQGHHKWPWTITRRQFAN-NLHAlara------ttitLLPLdl----- 189 Amborella trich...
XP_009109154 115 YILADLGSGLYHWAIDNYGDESTPLVGtQIEAARGHHKWPWIITIRQFAN-NSHAlargitftVLPLVLAC--------- 184 field mustard
EJK46293     149 wVAADFGSGIFHWSVDNYGNGRTPIMGnIIAAFQGHHSAPWTIAYRGFCN-NVYKlcipfgipTVAAINYLs-------- 219 Thalassiosira o...
XP_002287448   3 wVLADFGSGVFHWSVDNYGNGRTPVMGSIIAAFQGHHSAPWTITYRGFCN-NVWKlcipfglpTVAAISYIag------- 74  Thalassiosira p...
XP_002185277   1 wVIADFGSGVLHWATDNYGNGKTPVMGgIIAAFQGHHSAPWTIAQRGFCN-NVYKlcipfgivPMLAINAIA-------- 71  Phaeodactylum t...
Q4QCH1       153 tnhsgngyvanlhvRNIGVHVFLCTFFIFVAITNEIHKWSH-QA--KQSRIVRKAMDMDILLSPIAHRKHHKDPFDRT-- 227 Leishmania major
XP_003530742 195 --------------HDPIVEGFVVVCSGCIMFSQQFHAWSH-GTksRLPPLVVALQEAGVLVSRWQHAAHHRAPYNNN-- 257 soybean
XP_006346230 214 --------------KDPTTLAFVGVCSGCIMFSQQFHSWAH-GTksKLPSMVLALQDAGILVSREQHAAHHRVPYNNN-- 276 potato
XP_009420217 174 ------------ggGDAASHAFVGTCAGCVMLSQQFHAWAH-EKrsRLPAAVAALQEAGVLVSRPSHAAHHREPYNTN-- 238 wild Malaysian ...
XP_002888037 172 --------------NNPLFHSFVSIFAFCILLSQQFHAWAHgTTs-KLPPLVVALQDMGLLVSRKHHLGHHQAPYNSN-- 234 Arabidopsis lyr...
XP_006858154 190 ------------lpLDMGLEAFVSVCAGCIMFSQQFHAWAH-TPksRLSSIVIVLQDAGLLVSRSKHAAHHRTPYNNN-- 254 Amborella trich...
XP_009109154 185 --------------NDPVVHGFVSMFAFCILFCQQCHAWAH-ERksKLPPLVVAFQDMGLLLSRRQHVNHHRH-HRTYms 248 field mustard
EJK46293     220 -------------gDNSMAALFFTFFCWIEIMSQELHKWSH-QTkaEVPSIVNVLQDLGITIGRVPHAKHHTAPFEGN-- 283 Thalassiosira o...
XP_002287448  75 -------------pENSMVTLFFTFFCAIEIMSQELHKWSH-MTkkETPAFVNTLQALGVTIARVPHAQHHLAPYDGN-- 138 Thalassiosira p...
XP_002185277  72 ---------------PPDVVFFMATFCVFEIMSQEFHKWSH-QLksETPGWVNWLQDSGLTIARKPHALHHLAPFEGN-- 133 Phaeodactylum t...
Q4QCH1       228 YCITTGWLNPLLDSTNFWRHLESLVSSITGEIPRAN 263 Leishmania major
XP_003530742 258 YCIVSGVWNEFLDKHKVFEAMEMVLYFKTGVRPRSW 293 soybean
XP_006346230 277 YCIVSGLWNTILDESKFFELLEMIFFFKFGVRPRSW 312 potato
XP_009420217 239 YCIVSGVWNAALDRWKVFEAAEMLIFFRFGVRPRSW 274 wild Malaysian banana
XP_002888037 235 YCVVSGAWNKVLDESKFFEALEMALYFQFGVRPRSW 270 Arabidopsis lyrata subsp. lyrata
XP_006858154 255 YCIVSGVWNGALDEARFFEALEMVVFFRFGVRPRSW 290 Amborella trichopoda
XP_009109154 249 YCIVSGVWNNVLDDNKIFEALEKVLYVQFGVKPRSW 284 field mustard
EJK46293     284 YCIVSGLCNETLDRSGFFRWMEHTVYKINGVESNAW 319 Thalassiosira oceanica
XP_002287448 139 YCIVSGLCNETLDKSGFFRWMEHKVYELNGVESNAW 174 Thalassiosira pseudonana CCMP1335
XP_002185277 134 YCIISGICNPVLDQSGFFRRLERVVYSLNGIESNAW 169 Phaeodactylum tricornutum CCAP 1055/1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap