Conserved Protein Domain Family
Cir_N

?
pfam10197: Cir_N (this model, PSSM-Id:287204 is obsolete and has been replaced by 337665)
N-terminal domain of CBF1 interacting co-repressor CIR
This is a 45 residue conserved region at the N-terminal end of a family of proteins referred to as CIRs (CBF1-interacting co-repressors). CBF1 (centromere-binding factor 1) acts as a transcription factor that causes repression by binding specifically to GTGGGAA motifs in responsive promoters, and it requires CIR as a co-repressor. CIR binds to histone deacetylase and to SAP30 and serves as a linker between CBF1 and the histone deacetylase complex.
Statistics
?
PSSM-Id: 287204
View PSSM: pfam10197
Aligned: 153 rows
Threshold Bit Score: 26.6084
Threshold Setting Gi: 380495996
Created: 25-Jun-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|....*..
gi 122180212  10 GWHTGSIRNVEKVWKAEQKHEAEQEKIEERSEFRAIQ 46
gi 360043955   8 rWHVLKKENIARVRSDEAKYEEERRKIELKAQLADQE 44
gi 358333980 352 tWHVLTKENIARVRQDEAQYEEEQRQIKYRAKLAEQE 388
gi 751200256   8 rWHVRTKENIARVRRDEAKAAEEERIKKERAQKAETE 44
gi 308485770   8 SWHVRTKSNMERVRRDERKAAEDEQRVLDRQIQAENE 44
gi 380495996  10 SWNVYNADNIARVRRDEAAAKAKEEAEEQRMQEVDAE 46
gi 239607266  10 SWNVYNTDNIARVRRDEAEAKARGEEEQRRLQEIDAE 46
gi 521775644  23 SWNVYNKANIETVRRDEAAAKAAEEAEEERMQALDAE 59
gi 569408963  13 SWNVWNRDNRERVRRDEEKNAAKQRALGKRRKEMEAE 49
gi 299472936  12 SWHPGKRENIEKVLRDERLAAEEAAAARERAREITQE 48
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap