4GNK


Conserved Protein Domain Family
PLC-beta_C

?
pfam08703: PLC-beta_C (this model, PSSM-Id:285865 is obsolete and has been replaced by 312287)
Click on image for an interactive view with Cn3D
PLC-beta C terminal
This domain corresponds to the alpha helical C terminal domain of phospholipase C beta.
Statistics
?
PSSM-Id: 285865
View PSSM: pfam08703
Aligned: 17 rows
Threshold Bit Score: 174.08
Threshold Setting Gi: 542156145
Created: 27-Jun-2015
Updated: 5-Aug-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4GNK_B       1030 KRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVLDANTTQFKRLKEMNEREKKELQKILDRKRHNSISE 1109
gi 341941271 1029 KQYREFQNRQVQSLLELREAQADVETKRKLEHLRQAHQRLKEVVLDTHTTQFKRLKELNEREKKELQKILDRKRNNSISE 1108
gi 126278364  982 GRIRELKEKLEMELYQQGEEQYESIMKRKEAHGSELMDKVLKLAQEKQAAELKALKESADGNTKEMKKKLEVKRLERIQA 1061
gi 524997935  963 hcLVELRERLEMDLIHLGEEHHNRIRRKKEQHATEQVARILELAREKQAAELRVLRDTSESNIKDIKKRMEAKRVERVQA 1042
gi 637333163  981 NRVLELKDKLEEELLQLGEEQYDGIRKKKEQHATEHIAKIIELARDKQAAELKALKESCESDTKEMKKKLEAKRLDKVQT 1060
gi 565318511  912 nkmmelkekleeellhlgeeQYDAIWKKKDQHAIEKVAKMLQLAREKQASELKALKESWESNTKEMKKKLEVKRLDKIQA 991
gi 218563719 1014 KQMEQFREEHMQKLLVLRQGQLQMEKEVKQFHLKEANQKLKDIAIECQAAQIKKLKDVCDKEKKELQKMLDRKRLNSIVE 1093
gi 733887817   81 sQVVELKERLEMELIHLGEEYHDGIRRRKEQHATEQTAKITELAREKQIAELKALKESSESNIKDIKKKLEAKRLDRIQV 160
gi 551496237  992 KQKAQLWENNMQELLELRQGLYLQEKQMQLQHLAEEHEKLKLTVTEYQELHTKKLTDICSKEKKEIQKVLERKRIQSLLE 1071
gi 512835253  998 QKFMDMQLDQQKRLLELREIQHEQERKLKHSHLLQAVQKLQEVAISCHSTQLKKLKEINEKEKKELQKILDRKRHNSITE 1077
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4GNK_B       1110 AKMRDKHK-KEAELT-EINRRHITESVNSIRRLEEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQE 1187
gi 341941271 1109 AKTREKHK-KEVELT-EINRRHITESVNSIRRLEEAQKQRHERLVAGQQQVLQQLEEEEPKLLAQLTQECQEQRERLPQE 1186
gi 126278364 1062 MSKITSDKmAQERLKrEINNSHIQEVVHIIKQMTETLERHQERLEEKQAACLEQIREKGKQFQQEALSEYEERMKGLEAK 1141
gi 524997935 1043 MLRNTSDKaAQERLKkEINNSHIQEVVQTVKRMTEKTGRFQQKLEEKQAASLQSIKERESQLQQQVRVEYEERLRALNTE 1122
gi 637333163 1061 MTKNTTDKsTQERLKkEINNAHIQEVVQTVKQMNEKQNRFQQILEAKQAACIEKIKEKENQLQEEAFTEYEEKVKGLSAE 1140
gi 565318511  992 VAKNT-DKsAQERLKrEINNSHIQEVVKAVKQMNEKQSRHQQVLEAKQSTCLGKIKEKESQLQQEAFAEYENKMKTISAE 1070
gi 218563719 1094 ARKAE----KEIDVN-EINRKHIQESVSLIRQLEVSQGKRQEKLKALHKDILQKIEEEIPMNQARLTRDFEAELKRLPEE 1168
gi 733887817  161 MMRSTSDKaAQERLKkEINNSHIQEVVQTIKLLTEKTARYQQKLEEKQAENLRAIQEKEGQLQQEAVAEYEEKLKTLTVE 240
gi 551496237 1072 AKKKDPDL----KLS-DFNKKHINDCVEIFRKLEKLQSMRKEKFLLKHLEMTQQMESLLTQLESQLNEKLEEEYSQLPRE 1146
gi 512835253 1078 AKSRERQK-KDVELT-EINRRHINESVSSIRRLEEAQKRRQEKLQAAHQETLQRIKDEEPKLQAQLDESCQAEFRQLPQE 1155
                         170
                  ....*....|....*.
4GNK_B       1188 IRRSLLGEMPEGLGDG 1203
gi 341941271 1187 IRRCLLGETAEGLGDG 1202
gi 126278364 1142 VKEAVKCCLS--FPQD 1155
gi 524997935 1123 VQEMVKNYIKASFPGE 1138
gi 637333163 1141 VQDLVKTCVKVCFPLE 1156
gi 565318511 1071 VQDSVKNCMKVCYPLE 1086
gi 218563719 1169 ISQYLQELESKGSRKD 1184
gi 733887817  241 VQEVVKNYMKEVFPDG 256
gi 551496237 1147 ISQHLPSDLQNKGacm 1162
gi 512835253 1156 VRRYLQEDGWVgsgsg 1171
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap