Conserved Protein Domain Family
PDDEXK_10

?
pfam07788: PDDEXK_10 
PD-(D/E)XK nuclease superfamily
This family is found to carry modified motifs characteristic of PD-(D/E)XK endonuclease superfamily. These are the conserved Glu of motif I, the Asp surreounded by hydrophobics of motif II, EIKS of motif III, and the lysine of mmotif IV has migrated to an alpha-helix following the third core beta-strand. The conserved patch of positively charged lysine and arginine residues in the motif IV apha-helix might be involved in substrate-binding or be contributing to active site formation. Members with an additional N-terminal coi9led-coil domain, are annotated as tropomyosin, coiled-coil or microtubule binding proteins.
Statistics
?
PSSM-Id: 285082
View PSSM: pfam07788
Aligned: 14 rows
Threshold Bit Score: 79.6978
Threshold Setting Gi: 119525454
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam07788 is the only member of the superfamily cl14796
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 74573578  210 SEVEIDVVLSDGKVILVELTASLKRGELIQISRKRELYEKLKGKKVSEVIVVTPFIDDKNEERVIAIANSLGIK 283
gi 74577870  281 SIVEVDVVVKDGQHVLVEIKSQVTQADVAEMHRIGLLYERAEGVK-PRLVIVGGFVDER----ARALAERLGVE 349
gi 74573736  183 SDIEYDIIVKDGNVILIEITSSLKRGDLPIIKRKKELYEKVKNVKITLVYVITPFVHDRYPERVKAMAKDMGIE 256
gi 74541575  141 SDVEYDLMIEDGNLVMIEITSAIKRGDLPVIRKKKEFYERNKNVKISKVIVITPFLHDKYPDRLKAMAKDMGIE 214
gi 74538406  162 SDVEYDIVVKDSSVILVEITSSIRRGDLPTIKKKKEFYEKVKNIKVNLVYVITPFIHDRYPERIKAMAKDMGIE 235
gi 121724974 188 SDVEIDVVLKNGKVIMIEISSGIRRGDVGVILKKKEFYEKAKGVKVDEVIVITSIIEDRDPDRVKARAESLGIK 261
gi 503892313 240 SEVDYDVVVRDGRLIIVEIMSSLKRSDLPTIVKKRELYERARGAKVAAVYVVTPYIDDRYPERVKAMAKDLGLE 313
gi 500077008 171 AMVEVDVAVKDGEHILIEVKSSVSRGDVAVFRRIGELYEKVNRVK-PRLIMVSPYVDPR----ALEDARILGVE 239
gi 119525454  49 SEVEVDLVVRDREHILVEVKSRVSRGDVAELYRVGLLYEKLYGVK-PRLVLVGGFIDTD----AWETAGALGVa 117
gi 500076641 263 SRVEADILIKDKVHVLIEVKPSASSGDIAKLWRLGRLYEKKTGTK-PRLVLVTPFIEEE----ALKAAKQLGIE 331
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap