Conserved Protein Domain Family
JHBP

?
pfam06585: JHBP (this model, PSSM-Id:284096 is obsolete and has been replaced by 399529)
Haemolymph juvenile hormone binding protein (JHBP)
This family consists of several insect-specific haemolymph juvenile hormone binding proteins (JHBP). Juvenile hormone regulates embryogenesis, maintains the status quo of larval development and stimulates reproductive maturation in the adult insect. JH is transported from the sites of its synthesis to target tissues by a haemolymph carrier called juvenile hormone-binding protein (JHBP). JHBP protects the JH molecules from hydrolysis by non-specific esterases present in the insect haemolymph. The crystal structure of the JHBP from Galleria mellonella shows an unusual fold consisting of a long alpha-helix wrapped in a much curved antiparallel beta-sheet. The folding pattern for this structure closely resembles that found in some tandem-repeat mammalian lipid-binding and bactericidal permeability-increasing proteins, with a similar organization of the major cavity and a disulfide bond linking the long helix and the beta-sheet. It would appear that JHBP forms two cavities, only one of which, the one near the N- and C-termini, binds the hormone; binding induces a conformational change, of unknown significance. This family now includes DUF233, pfam03027.
Statistics
?
PSSM-Id: 284096
View PSSM: pfam06585
Aligned: 237 rows
Threshold Bit Score: 121.9
Threshold Setting Gi: 170052627
Created: 13-Jul-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O76879         8 MFLVWVGLLSwvscrvdASEGFPSPLKR----CKLQd---ESCLLAQAQTFFQAFKNGI-PERQVAALEPIALGTMFIEs 79  fruit fly
ETN59353       6 ALLAMVAVLSn------AAVIVPR--EP----APRTt--lNEALAQLLENIRELLRTGD-PERGLPVLAPLQTDRLDVD- 69  Anopheles darlingi
XP_551486      5 FALVALFVVAs------NAATIPHQPSRpealAPEQratlDEALAQLLENIRELLRTGD-PERGIPVMAPLETDRLDVD- 76  Anopheles gambi...
XP_002054453   1 -----------miakfsllallvvvasaspvtqdtsmvnyGEAVEMFLDAWKKMLPCGY-APDNIPVMAPLTVDFYAFD- 67  Drosophila virilis
XP_001994860   1 -----------miakvflltllvavasatpvtqdtsmvgyreamdmFLDAWKKMIPCGF-PSENIPVLAPLTTDFYAFN- 67  Drosophila grim...
XP_001952955   8 LLLAIVGLSVt------SATPV-----V----QQPGsaqfTSSMTRFLEAFRSIMPCGF-N--GIPVLAPLETPFYEFE- 68  Drosophila anan...
XP_002057481   7 VLAAVLCCSLc------AGRTLf-----------------DDDLREFTEFLRLQMHCGY-PERGIPILAPAQLAYKELD- 61  Drosophila virilis
XP_002137511   6 FLVALLGIALv------SATPVPQ---------QAAsanfSSAMTRYIQAFKSIMPCGYaPD--IPVLAPIVNPFYAFD- 67  Drosophila pseu...
XP_002043757  11 ALLALTVVNAn------PVVQQPASaq------------fTSAVSRFLRAFRSIMPCGY-GDL--PVMSPIVSPFYEFE- 68  Drosophila sech...
ETN59354       9 ALMALTATGV------------N---EV----AGQNii-lDAIMRRILENLRELMRTGN-PETGMPVLAPYNNPDLFIN- 66  Anopheles darlingi
O76879        80 GGhSESIKFKLTMSDAKLYNLaNSMMVKSLKGFTKDltRPlkLTLLLDNPELEVR-AKYDVD--GKL----LI----L-P 147 fruit fly
ETN59353      70 LSlGGLLDFTAILNNLYLDGL-DRFQGT-LTLNVML--ME--FTYDFLFPDLLAR-GQYDAD--GRL----FG----LiP 132 Anopheles darlingi
XP_551486     77 LSlGGLLDFTAILRNLFVDGL-DRFQGT-LTLNVMQ--ME--FRYDFLFPDVVAR-GHYDAN--GRL----FG----LiP 139 Anopheles gambi...
XP_002054453  68 YN-NGETNIVGNVSNIRISGL-NNFQVLSGSFNPNT--LR--STYDVLYPEIQIF-GSYEVE--GVI----SIagfpV-P 133 Drosophila virilis
XP_001994860  68 YN-NGETNLVGNVSNIRISGL-NNFQVLSGSYDPTT--LR--ATFDVLFPELQIL-GSYEVE--GTVgiggLP----L-P 133 Drosophila grim...
XP_001952955  69 YI-SDDYTVVGNVSNMRIEGL-DGFQVLSASDYGKT--GE--AAYDLLFPKIQFL-GSSDVE--GFI----NIggikV-P 134 Drosophila anan...
XP_002057481  62 IH-TDSFSCKGNFTDLSVVGL-DGFEFFQLQWNNIF--HT--IKFDVSFPSIQLKsAAYKLDllGRI----FG----A-N 126 Drosophila virilis
XP_002137511  68 CS-SDDYNLKGNVSNIRIEGL-NNFQILSASDYGTT--GE--AAYDVIFPKIQIL-GSSEIE--GFV----NIagvpL-P 133 Drosophila pseu...
XP_002043757  69 HI-SEDFSVVGNVTNIRIQGI-DGFQVLSASDYGKT--GE--AAYDVLFPKIQVL-GFAEID--GFI----NIggfkV-P 134 Drosophila sech...
ETN59354      67 ASfGGLLDFDARFTPMNIVGL--DTFVGRLQVDLAS--LR--FPFEFRFDELTAS-GFYDAN--GRL----WG----LiP 129 Anopheles darlingi
O76879       148 --IVSKGDLTIRLNDVHTKVWITAEPVKRsDGHTYLNITDYKTATKIKGGH-F-DLSNLFNdNKELRDSTLKVLNQ---- 219 fruit fly
ETN59353     133 --VFGFGNFNVQPRNLRIQGTAQIRQLP----SGYLHMTELKANVRLGSLQ-N-NIEGMLLg-GELSDLLNAVIQD---- 199 Anopheles darlingi
XP_551486    140 --VFGLGNFHVAPRDLRIQGTALLRQLP----SGYLHMPELKANVRLGSLQ-N-NIEGMLLg-GELSDLLNVVIQD---- 206 Anopheles gambi...
XP_002054453 134 --IRQSVLINKKLTDWRFVGDYTFAQSLS-N-SNGLRISDFNLHYFVGDVK-V-D-----NwDKYLDIAANNYFNDifgs 202 Drosophila virilis
XP_001994860 134 --IRQSVLINKKLSDWRFVGDYTFAQSLS-N-SNGLRLADFNLQYFVANVQaA-NWNKFM--DIATNNYFNSFINS---- 202 Drosophila grim...
XP_001952955 135 --IRQKAVINEALIDLRFVGSYSFANSQT-N-SSGLRIIDFQQSVYLAGVR-MdNRNTLWNiST--NNFWNRVMNT---- 203 Drosophila anan...
XP_002057481 127 tsLGCNGRFDLELINLRANGSFVLRPS---GLTNGVHITSWNVGWQLGKAV-S-QTTGI-GsTQIVTKILNAIIQD---- 196 Drosophila virilis
XP_002137511 134 --IRQRDLINEAFVDLRFVGSYSFANSLT-N-SSGLRIVDFKLAIYLADIQ-LdNWNTLWNiST--NNFWNRWSKT---- 202 Drosophila pseu...
XP_002043757 135 --IQQNDVINEALVDLRFVGSYSFDNSLT-N-SSGLRMVNFRQTIYLAGAE-FdNWNTLWNiST--NNFWNRLMQS---- 203 Drosophila sech...
ETN59354     130 --VFGIGDFTVRPRNVLATGFATIT--DN--GQGFLMLSDFSISLQMDALD-S-NIQGLLLg-GDLSVLLNAVLQD---- 196 Anopheles darlingi
O76879       220 EWSTLALDVQPKINEACAK-AFSAIVQSLWANIPYDEFFE 258 fruit fly
ETN59353     200 LVPSVLVNFAPEVTDIISR-VGIPIADSILNTMTLDDLFg 238 Anopheles darlingi
XP_551486    207 LIPSVLINFAPEVTDIISR-VGIPIADSVLNTMTLEDLFa 245 Anopheles gambiae str. PEST
XP_002054453 203 FSLLFTQEIQPYIKPFYGK-YVLPSINNMLSNLSLTQLad 241 Drosophila virilis
XP_001994860 203 FSLLFTEEIQPYVNPMLEK-YLLPTINNLLSNVDMTQLtn 241 Drosophila grimshawi
XP_001952955 204 YAPLALQEMQPGLTNFLYQnYMIPKINDLLANVSMAELVD 243 Drosophila ananassae
XP_002057481 197 FLELLINDNPQEVSQFMEQ-LITPPMNTVLENVAWYEIta 235 Drosophila virilis
XP_002137511 203 LFSLGLQEIQPKITDSLYQnLLVPKINEMLANVSMEELVn 242 Drosophila pseudoobscura pseudoobscura
XP_002043757 204 LLPLALEEIQPNITNILYQnFFVPKINDLLANVSMSELVs 243 Drosophila sechellia
ETN59354     197 IVPSILRNFPDGMTNLLNA-LVVPIANRFLATRTMEDLMG 235 Anopheles darlingi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap