3WJM,3WJM


Conserved Protein Domain Family
Hemocyanin_N

?
pfam03722: Hemocyanin_N (this model, PSSM-Id:281684 is obsolete and has been replaced by 397678)
Click on image for an interactive view with Cn3D
Hemocyanin, all-alpha domain
This family includes arthropod hemocyanins and insect larval storage proteins.
Statistics
?
PSSM-Id: 281684
View PSSM: pfam03722
Aligned: 87 rows
Threshold Bit Score: 85.628
Threshold Setting Gi: 195427301
Created: 11-Jul-2015
Updated: 5-Aug-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3WJM_E        35 VEKQKKILSFFQDVSQLNTD-DEYYKIGKDYDIEMnmDNYTNKKA-VEE-FLKMYRTG-FMPKNLEFSVFYDKMRDEAIA 110 domestic silkworm
XP_002042823  33 LMKQKFLFEIVYRVEDPLMF-EEYIAMGKQFFFEK--EHYTHFDL-YMDkFFEAHKAHaLLPKGEFFGALVKHHAKQARG 108 Drosophila sech...
XP_001996995  33 LEKQKFFFEIVYRLEDPLMF-EEYIKDGKNFYFDE--AYYTHYDIyMKK-FAEAFKAHsLLPKGEFFGQLVKTHAKQARG 108 Drosophila grim...
XP_001237381  43 LVKQKFFFEILRHLHQPIAF-EEYLPYTSRWVTDP--SKYTNYTE-VAE-FIQTYEQG-VLKKGQIFTIYNYWYAKETVQ 116 Anopheles gambi...
XP_001850700  35 LVKQKFFFEILRNIYQPLEF-EEYLPYTKSWVEDE--TKYTDYAK-VSE-FFALFKTG-FLPKGEIYTIFNYWYMKQTQL 108 southern house ...
ETN65808      46 LSKQKFFFEILRHLHQPLTT-EEYLPFAKEWIQEQ--SKYLNYTE-VTE-FQRAFGHG-FLAKGAIFTIYNYWYAKQTLL 119 Anopheles darlingi
XP_001955758  33 LEKQKFLFEIVYRLEDPLMF-EDYIKMGSSLFIEK--SYYTTFDK-YMEiFYDAYKVGaLLPKGEFFGALVKTHAKQARG 108 Drosophila anan...
AAB71667      32 LEKQKFLFEIVHRVDEPLMF-EEWIKMGQKLITDK--AQYETFDF-YMEkFWESYKLGaLLPKGEFFGALVKTHHKQAYG 107 Drosophila simu...
XP_001985799  35 LVKQKFVFEMLQHVYQDDVFvTKYDASFYEYKPWEhvGDYDHPEK-FQD-FFELWQHHpF-HNDQVWTLFYDRHEEYAHG 111 Drosophila grim...
XP_002017610  34 LGKQKFVFDMLQHIYQDDVFvSEYPATYAEYKPWDhvGDYHHPEL-LEH-FFELWQHHpF-HDDQVWSVMYERHEEYAVG 110 Drosophila pers...
3WJM_E       111 LFHLFYYAKDFETFYKTACFARVHLNQGQFLYAFYIAVIQRSDCHG 156 domestic silkworm
XP_002042823 109 LFNFFYYAKDWETFAANVAFARMHFNEGMFVYALTLAVIHRDDFHG 154 Drosophila sechellia
XP_001996995 109 LFNFFYYAKDWETFYHNVCWARMHVNEGMFVYALTLAVIHRPDFHG 154 Drosophila grimshawi
XP_001237381 117 LYRFFENAIDWDTYYKNVVWARANLNEGMFLSALTLSVLHRKDLQG 162 Anopheles gambiae str. PEST
XP_001850700 109 LFDFFYYSADWATLYKNVVWARENTNEGMFMYAVTLVVLHRKDLQG 154 southern house mosquito
ETN65808     120 LYRFFENALDWDTYYKNVIWARQHTNEGMFLCALTLSVLHRPDLQG 165 Anopheles darlingi
XP_001955758 109 LFNFFYYAKDWETFMHNVAWARMHVNEGMFVYALTLAVIHREDFHG 154 Drosophila ananassae
AAB71667     108 LFNFFYYAKDWETFVRNVAWARIHVNEGMFVYALTLAVIHKPEFEG 153 Drosophila simulans
XP_001985799 112 LVRLFYYAKNWETFQHAVFWAREHVNTQLFVYAFTIACLHRADLQG 157 Drosophila grimshawi
XP_002017610 111 LVRLFYFAKNWETFQHAVFWARQHVNKQLFVYAFTVVTIARDDMQG 156 Drosophila persimilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap