Conserved Protein Domain Family
BESS

?
pfam02944: BESS (this model, PSSM-Id:281011 is obsolete and has been replaced by 427071)
BESS motif
The BESS motif is named after the proteins in which it is found (BEAF, Suvar(3)7 and Stonewall). The motif is 40 amino acid residues long and is composed of two predicted alpha helices. Based on the protein in which it is found and the presence of conserved positively charged residues it is predicted to be a DNA binding domain. This domain appears to be specific to drosophila.
Statistics
?
PSSM-Id: 281011
Aligned: 95 rows
Threshold Bit Score: 30.0358
Threshold Setting Gi: 195455889
Created: 24-Jun-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9VXS5       200 ESNRHFLLSMVPMLRSLSDRSKERFRSWTRRVLRE 234 fruit fly
Q16ZV3       316 DSDYNFLMSLHPFMRKLPGRKNLSVRIKIQQLIAE 350 yellow fever mosquito
XP_001861807 299 DSDYNFLMSLHPFMQQLNTKRNLAIRIKMQQLIAE 333 southern house mosquito
EHJ79246     442 DSDKLFLLSFLTEMKQLPANIKMWARAQIANVMQE 476 monarch butterfly
XP_004928975 184 DSDKLFLLSFLPEMRQLPVHLKMWVRSQIANTMQE 218 domestic silkworm
NP_001127789 219 DYDKMFLLSLLPIMRKLPEEKKLDVRIQMQQVIAQ 253 jewel wasp
XP_002129205 173 DADELFFASVLCEISGLPPKKKGKLKIDIMNLVHN 207 vase tunicate
XP_004927715 114 DEDIGFFNSLLPHVKKLGPAKKLMLRMKIQELVYN 148 domestic silkworm
XP_001604307 508 sDDYHFFMSLMPHVKNFTSLQKLKVRQRIQQIIIE 542 jewel wasp
XP_001986304 344 DADRMFLLSLMPFLQRLDERRKLRVRQKLQNVLIE 378 Drosophila grimshawi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap