Conserved Protein Domain Family
Parvo_coat

?
pfam00740: Parvo_coat 
Click on image for an interactive view with Cn3D
Parvovirus coat protein VP2
This protein, together with VP1 forms a capsomer. Both of these proteins are formed from the same transcript using alternative splicing. As a result, VP1 and VP2 differ only in the N-terminal region of VP1. VP2 is involved in packaging the viral DNA.
Statistics
?
PSSM-Id: 279128
View PSSM: pfam00740
Aligned: 4 rows
Threshold Bit Score: 552.305
Threshold Setting Gi: 75765668
Created: 14-Jun-2015
Updated: 5-Aug-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam00740 is a member of the superfamily cl08286.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1Z14_A         1 GVGVSTGSYDNQTHyrFLGDGwveITALATRLVHLNMPKSENYCRIRVHNTTDTSV---KGNM---AKDDAHEQIWTPWS 74
gi 635377450  80 GVGNSTGGFNNTTEfkVINNEv-yITCHATRMVHINQADTDEYLIFNAGRTTDTKThqqKLNLeffVYDDFHQQVMTPWY 158
3J1S_A         4 GVGNSSGNWHCDST--WMGDR---VITTSTRTWALPTYNNHLYKQISSQSGA--------------SNDNHYFGYSTPWG 64
gi 81975804  244 GSNPVKSMWSEGAT--FSANS---VTCTFSRQFLIPYDPEHHYKVFSPAASSCHNAsgkEAKV---CTISPIMGYSTPWR 315
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1Z14_A        75 LVDANAWGVWLQPSDWQYICNTMSQLNLVSLDQEIFNVVLKTVTEQDLGGQAIkiyNNDLTACMMVAVDSNNILPYTPAA 154
gi 635377450 159 IVDSNAWGVWMSPKDFQQMKTLCSEISLVTLEQEIDNVTIKTVTETNQGNASTkqfNNDLTASLQVALDTNNILPYTPAA 238
3J1S_A        65 YFDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTQNDGTTTIA----NNLTSTVQVFTDSEYQLPYVLGS 140
gi 81975804  316 YLDFNALNLFFSPLEFQHLIENYGSIAPDALTVTISEIAVKDVTDKTGGGVQV---TDSTTGRLSMLVDHEYKYPYVLGQ 392
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1Z14_A       155 NSMETLGFYPWKPTIASPYRYyfcv---drdLSVTYENQEGTVEHNVMGTPKgmNSQFF---TIENTqQITLLRTGDEFA 228
gi 635377450 239 PLGETLGFVPWRATKPTQYRYyhpcyiynryPNIQKVATETLTWDAVQDDYLsvDEQYFnfiTIENNiPINILRTGDNFH 318
3J1S_A       141 AHQGCLPPFPADVFMVPQYGY----------LTLNN-GSQAVG-----------RSSFY---CLEYF-PSQMLRTGNNF- 193
gi 81975804  393 GQDTLAPELPIWVYFPPQYAY----------LTVGDVNTQGISGDSKKLASE--ESAFY---VLEHS-SFQLLGTGGT-A 455
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1Z14_A       229 TGTYYFDT-----------------NPVKLTHTWQTNRqLGQP---------------------------PL----LSTF 260
gi 635377450 319 TGLYEFNS-----------------KPCKLTLSYQSTRcLGLP---------------------------PLckpkTDTT 354
3J1S_A       194 TFSYTFEDvpfhssyahsqsldrlmNPLIDQYLYYLSR-TNTPsgtttqsrlqfsqagasdirdqsrnwlPGpcyrQQRV 272
gi 81975804  456 TMSYKFPPvppenlegcsqhfyemyNP------LYGSR-LGVPdtlggdpkfrslt--hedhaiqpqnfmPGp--lVNSV 524
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1Z14_A       261 PEADTD---AGTLTA-QGSRHgtTQMGVNw-------vSEAIRTRPAQVGFCQPHNDFEASRAGPFAA--PKVPADITQG 327
gi 635377450 355 HKVTSKengADLIYI-QGQDN--TRLGHFwgeergkknAEMNRIRPYNIGYQYPEWIIPAGLQGSYFAggPRQWSDTTKG 431
3J1S_A       273 SKTSADnnnS------EYSWTgaTKYHLN---------GRDSLVNPGPAMASHKDDEEKFFPQSGVLIfgKQGSEKTNVD 337
gi 81975804  525 STKEGDssnTGAGKAlTGLSTgtSQ-------------NTRISLRPGPVSQPYHHWDTDKYVPGINAI----SHGQTTYG 587
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1Z14_A       328 VDK-----EANGSVRYSYGKQH-GENWASHGPA---PERYTWDetsfgsgrdTKDGFIQSAPLVVPPPLNGILTNanp-- 396
gi 635377450 432 AGThsqhlQQNFSTRYIYDRNHgGDNEVDLLDGipiHERSNYYsd-----neIEQHTAKQPKLRTPPIHHSKIDSweeeg 506
3J1S_A       338 IEKvmitdEEEIRTTNPVATEQyGSVSTNLQRG---------------------NRQAATADVNTQGVLPGMVWQ----- 391
gi 81975804  588 NAEdk--eYQQGVGRFPNEKEQ-----LKQLQG---LNMHTYF---------PNKGTQQYTDQIERPLMVGSVWN----- 643
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1Z14_A       397 igtKNDIHFSnvfnsygplta-------------------------------fshpspvypqGQIWDKELDLE--HKPRL 443
gi 635377450 507 wpaASGTHFEdeviyldyfnfsgeqelnfphevlddaaqmkkllnsyqptvaqdnvgpvypwGQIWDKKPHMD--HKPSM 584
3J1S_A       392 ---DRDVYLQ----------------------------------------------------GPIWAKIPHTDghFHPS- 415
gi 81975804  644 ---RRALHYE----------------------------------------------------SQLWSKIPNLDdsFKTQF 668
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1Z14_A       444 HITAPFVCKnNAPGQMLVRLGP-----------NLTD------------QYDPNGatlsrivtygtffwkgKLTMRAKL- 499
gi 635377450 585 NNNAPFVCKnNPPGQLFVKLTE-----------NLTDt----------fNYDENPdriktyg---yftwrgKLVLKGKL- 639
3J1S_A       416 PLMGGFGLK-HPPPQILIKNTPvp--------aNPSTtfsaakfasfitQYSTGQv---------------sVEIEWELq 471
gi 81975804  669 AALGGWGLH-QPPPQIFLKILPqsgpiggiksmGITTl----------vQYAVGIm---------------tVTMTFKLg 722
                        650       660       670
                 ....*....|....*....|....*....|....*...
1Z14_A       500 --RANTTWNPVYQ-------VSAEDNGNSYMsvtkwlP 528
gi 635377450 640 --SQVTCWNPVKReligepgVFTKDKYHKQI------P 669
3J1S_A       472 -kENSKRWNPE---------IQYTSNYNKSVnvdftvd 499
gi 81975804  723 prKATGRWNPQPG-------VYP-PHAAGHL------P 746
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap