2C3E,4C9H,2LCK,4C9Q,4C9H,2C3E


Conserved Protein Domain Family
Mito_carr

?
pfam00153: Mito_carr (this model, PSSM-Id:278578 is obsolete and has been replaced by 395101)
Click on image for an interactive view with Cn3D
Mitochondrial carrier protein
Statistics
?
PSSM-Id: 278578
Aligned: 161 rows
Threshold Bit Score: 55.3551
Threshold Setting Gi: 74676440
Created: 11-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2C3E_A         3 QALSFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHAS-KQisaek--------qykgIIDCVVRIPKEQGF-LSFWRG 72  cattle
P53257        12 QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANgLKpfg------------sqVMEVARSMIKNEGI-RSFWKG 78  Saccharomyces c...
O65023       276 K---AQSSLLTAVLSAGIATLTCYPLDTVRRQMQMRGTPyKS-----------------IPEAFAGIIDRDGL-IGLYRG 334 thale cress
O04619       240 NELTVVTRLTCGAIAGTVGQTIAYPLDVIRRRMQMVGWKdASaivtgegrstasleytgMVDAFRKTVRHEGF-GALYKG 318 thale cress
Q20799       438 SEPGVLALLACGTCSSTCGQLSSYPFALVRTRLQALSITrYSpqp------------dtMFGQFKYILQNEGV-TGFYRG 504 Caenorhabditis ...
Q93717       201 V-ENSYYRMLFGMLAGLIGQSSSYPLDIVRRRMQTGRIPsGWs----------------PLRALIHIYHTEGLkRGLYKG 263 Caenorhabditis ...
Q86VD7       222 RQPYPFERMIFGACAGLIGQSASYPLDVVRRRMQTAGVTgYPra--------------sIARTLRTIVREEGAvRGLYKG 287 human
Q19422        54 YKFYPMALCSSWTIRCML-----YPMSVVKSRLQLQRQNnVYn---------------gMRDAFVKIIRQEGI-GALYKG 112 Caenorhabditis ...
Q07534       113 PRLTMYENLLTGAFARGLVGYITMPITVIKVRYESTLYNySS-----------------LKEAITHIYTKEGL-FGFFRG 174 Saccharomyces c...
NP_001255632  11 EPLTSAEYSEAGLASGIVTRMIIQPLDVLKIRFQLQEEPiRGkksg---------kykgVMQSIFLITREEGA-HAFWKG 80  Caenorhabditis ...
2C3E_A        73 NLANVIRYFPTQALNFAFKDKYKQIFLGGV 102 cattle
P53257        79 NIPGSLLYVTYGSAQFSSYSLFNRYLTPFG 108 Saccharomyces cerevisiae S288c
O65023       335 FLPNALKTLPNSSIRLTTFDMVKRLIATSE 364 thale cress
O04619       319 LVPNSVKVVPSIAIAFVTYEMVKDVLGVEF 348 thale cress
Q20799       505 ITPNFLKVIPAVSISYVVYEKVRTGLGVPV 534 Caenorhabditis elegans
Q93717       264 LSMNWLKGPIAVGVSFTTYEKVLELV-GHL 292 Caenorhabditis elegans
Q86VD7       288 LSMNWVKGPIAVGISFTTFDLMQILL-RHL 316 human
Q19422       113 FWMTLPQLS-ASFLYSSAYERVRDLLQTHL 141 Caenorhabditis elegans
Q07534       175 FGATCLRDAPYAGLYVLLYEKSKQLLPMVL 204 Saccharomyces cerevisiae S288c
NP_001255632  81 HIPAQGLSATYGLVQFSSFE----WLSQQA 106 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap