Conserved Protein Domain Family
Filament

?
pfam00038: Filament (this model, PSSM-Id:278467 is obsolete and has been replaced by 333788)
Intermediate filament protein
Statistics
?
PSSM-Id: 278467
View PSSM: pfam00038
Aligned: 28 rows
Threshold Bit Score: 283.732
Threshold Setting Gi: 89273773
Created: 10-Jun-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125961      29 QEKEDLQELNDRLAVYIDKVRSLELENAGLRLRITESEEV--V-SREVSgIKAAYEAELADARKTLDSVAKERARLQLEL 105
gi 82654947   150 EEREQIKLLNNKFASFIDKVQFLEQQNKVLETKWNLLQQQttT-TSSKN-LEPLFETYLSVLRKQLDTLGNDKGRLQSEL 227
gi 239938650  177 QEREQIKTLNNKFASFIDKVRFLEQQNQVLQTKWELLQQM--NvGTRPInLEPIFQGYIDSLKRYLDGLTAERTSQNSEL 254
gi 129822      93 NEKQELQELNDRFANFIEKVRFLEQQNAALRGELSQARGQ------EPArADQLCQQELRELRRELELLGRERDRVQVER 166
gi 121135      68 SERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAK------EPTkLADVYQAELRELRLRLDQLTANSARLEVER 141
gi 118453      98 NEKVELQELNDRFANYIEKVRFLEQQNALMVAEVNRLRGK------QPTrVAEMYEEELRELRRQVDALTGQRARVEVER 171
gi 82195670   122 NEKAEMQELNDRFANFIDKVRFLEQQNKILVAELEQLKGK------GTSrIGDLYEEEMRELRRQLDQVTNAKDRVEVDR 195
gi 82200963    83 NEKEQLQGLNDRFVTYIEKVHQLEQQNKLLEAEVTLLRQK----HSEPSrLSQIYEQEIRELRSRLEEQEQEKDQAELDY 158
gi 1703221     93 NEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQR----HAEPSrVGELFQRELRELRAQLEEASSARAQALLER 168
gi 226726294   96 SEKEQLQALNDRFAGYIDKVRQLEAHNRSLEGEAAALRQQ----QAGRSaMGELYEREVREMRGAVLRLGAARGQLRLEQ 171
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125961     106 SKVREEHKELKARNAKKeadllaaqarlkdleallnskeaalstaLGEKRNLENEVRDLRaqvaklegalseakKQLQDE 185
gi 82654947   228 KTMQDSVEDFKTKYEEE----------------------------INKRTAAENDFVVLK--------------KDVDAA 265
gi 239938650  255 NNMQDLVEDYKKKYEDE----------------------------INKRTAAENDFVTLK--------------KDVDNA 292
gi 129822     167 DGLAEDLGALKQRLEEE----------------------------TRKREDAEHNLVLFR--------------KDVDDA 204
gi 121135     142 DNLAQDLATVRQKLQDE----------------------------TNLRLEAENNLAAYR--------------QEADEA 179
gi 118453     172 DNLLDNLQKLKQKLQEE----------------------------IQLKQEAENNLAAFR--------------ADVDAA 209
gi 82195670   196 DNLADDLQRLREKLQDE----------------------------MIQKEEAEGNLQSFR--------------QDVDNA 233
gi 82200963   159 EHLGTCLQQLKMKLEQE----------------------------SGRREEAEDTLKNYR--------------KDLDQA 196
gi 1703221    169 DGLAEEVQRLRARCEEE----------------------------SRGREGAERALKAQQ--------------RDVDGA 206
gi 226726294  172 EHLLEDIAHVRQRLDDE----------------------------ARQREEAEAAARALA--------------RFAQEA 209
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125961     186 MLRRVDAENRLQTLKEELEFQKNIYSEELRETKRRH-------ETRLVEIDN-GRQQEfeskLAEALQDLRRQHEDQIRH 257
gi 82654947   266 YLNKVELEAKVDSLNDEINFLKVLYDAELSQMQTHVs-----dTSVVLSMDN-NRNLD----LDSIIAEVRAQYEEIAQR 335
gi 239938650  293 YMIKVELQSKVDLLNQEIEFLKVLYDAEISQIHQSVt-----dTNVILSMDN-SRNLD----LDSIIAEVKAQYEEIAQR 362
gi 129822     205 TLSRLELERKIESLMDEIEFLKKLHEEELRDLQVSVes----qQVQQVEVEA-TVKPE----LTAALRDIRAQYENIAAK 275
gi 121135     180 TLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLa-----rQQVHVELD--VAKPD----LTAALKEIRTQYEAMASS 248
gi 118453     210 TLARIDLERRIESLQEEIAFLKKVHEEEIRELQAQLq-----eQHIQVEMD--ISKPD----LTAALRDIRAQYESIAAK 278
gi 82195670   234 SLARIDLERKVESLQEEIVFLKKLHDEEIRELQLQIq-----eSHIQVDMD--VSKPD----LTAALRDVRQQYENVAAK 302
gi 82200963   197 TLNRLQLEKKVESLLDEIAFLRKVHEEEIAELQASVq-----eAQTSVEMDV-VSKPD----LTAALKEIRMQYEVLSAR 266
gi 1703221    207 TLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLqa----sSQAAAEVDVaVAKPD----LTSALREIRAQYESLAAK 278
gi 226726294  210 EAARVDLQKKAQALQEECGYLRRHHQEEVGELLGQIqgsgaaqAQMQAETRD-ALKCD----VTSALREIRAQLEGHAVQ 284
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125961     258 YRDELEKTYGAKLENAKQSAERNSSMAGAAHEELQQTHIRIDSLSAELSQLQKQLAAKEAKLREVEEALSREREGGRRLL 337
gi 82654947   336 SKAEAEALYQTKVQQLQISVDQHGDNLKNTKSEIAELNRMIQRLRAEIENIKKQCQTLQVSVADAEQRGENALKDAHSKR 415
gi 239938650  363 SKEEAEALYHSKYEELQVTVGRHGDSLKEIKIEISELNRVIQRLQGEIAHVKKQCKNVQDAIADAEQRGEHALKDARNKL 442
gi 129822     276 NLQEAEEWYKSKYADLSDAANRNHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALEAGGYQAGA 355
gi 121135     249 NMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEAL 328
gi 118453     279 NIAEAEEWYKSKVSDLTQAANKNNDALRQAKQEMLEYRHQIQSYTCEIDALKGTNDSLMRQMREMEERFAGEAGGYQDTI 358
gi 82195670   303 NLSDAEDWYKSKFADLSEAANRNNDALRQAKQDANDYRRQIQTLTCEIDAMKGSNESYERQMREMEENFAGEAANYQDTI 382
gi 82200963   267 NQQSSEEWYQAKIANVSLEASRNNDSVRQAKEEISEYRRQLQARTLEIDALRSANESLERQLQESEDRNNEEISHLQDTI 346
gi 1703221    279 NLQSAEEWYKSKFANLNEQAARSTEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSI 358
gi 226726294  285 STLQSEEWFRVRLDRLSEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKDSLERQRSELEDRHQADIASYQEAI 364
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*...
gi 125961     338 AEKEREMAEMRARMQQQLDEYQELLDIKLALDMEINAYRKLLEGEEER 385
gi 82654947   416 VELEAALQQAKEELARMLREYQELMSVKLALDIEIATYRKLLEGEEYR 463
gi 239938650  443 NDLEEALQQAKEDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECR 490
gi 129822     356 ARLEEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLLEGEESR 403
gi 121135     329 ARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENR 376
gi 118453     359 ARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEENR 406
gi 82195670   383 QRLQEEIHNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESR 430
gi 82200963   347 GQLDNALRTTKEEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETR 394
gi 1703221    359 GQLESDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETR 406
gi 226726294  365 QQLDAELRNTKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEECR 412
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap