Conserved Protein Domain Family
poly_P_kin

?
TIGR03705: poly_P_kin 
Click on image for an interactive view with Cn3D
polyphosphate kinase 1
Members of this protein family are the enzyme polyphosphate kinase 1 (PPK1). This family is found in many prokaryotes and also in Dictyostelium. Sequences in the seed alignment were taken from prokaryotic consecutive two-gene pairs in which the other gene encodes an exopolyphosphatase. It synthesizes polyphosphate from the terminal phosphate of ATP but not GTP, in contrast to PPK2. [Central intermediary metabolism, Phosphorus compounds]
Statistics
?
PSSM-Id: 274734
View PSSM: TIGR03705
Aligned: 41 rows
Threshold Bit Score: 915.759
Threshold Setting Gi: 499419851
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

TIGR03705 is classified as a model that may span more than one domain.
TIGR03705 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XDO_A         6 YIEKELSWLSFNERVLQEAADKSNPLIERMRFLGIYSNNLDEFYKVRFAELKRRIIISEEQGSNS---HSRHLLGKIQSR 82
gi 692528511   9 YTNRELSWLDFNYRVLDEARDKDNPLLERVRFLGITQSNLDEFFTVRVASLRKLMSVNYTKPDPAg-lTAADQVSAISDK 87
gi 499998433  10 YVNREMSWLAFNKRVLEEGRDTQNPILERANFLAITQKNMDEWFMVRVASLQQQMFVGHDKVDASg-lSPKQQLIKISAA 88
gi 499536700   7 YIEKELSWLSFNERVLQEAADKSVPLIERVRFLGIFSSNTDEFYKVRFADIKRRILINQVQGGDD---VAKHLLSKIQSR 83
gi 500025913   7 YEEKELSWLSFNERVLQEAMDKTVPLIERVRFLGIFSSNQDEFFKVRVSDVKRRILINEVHGGDD---EAKVLLRAIQQK 83
gi 447194316   7 YIDKELSWLSFNERVLQEAADKTVPLIERIRFLGIFSNNLDEFYKVRFADVKRQILINRERGGND---ISKHLLSRMQSK 83
gi 446167149   9 YIEKELSWLSFNERVLQEAADKSNPLIERMRFLGIYSNNLDEFYKVRFAELKRRIIISEEQGSNS---HSRHLLGKIQSR 85
gi 499945667   9 SIDKEISWLSFNERVLQEACDPNVPIVERVRFLGIFSNNMDEFFRVRVAAVRRSILLSALQEGRSn---SRHLMAKIQTK 85
gi 499895324   8 YFSREISWLAFNQRVLQEAADRKNPIVERIRFLGIYSSNMDEFYRVRVADVKRKIYIHLDEGDNEkaeQTKILMEQIQEK 87
gi 499419851  12 YVERDISWMYFNQRILLEAARPEVPLLERLTFLGIYSNNLDEFFRVRVATLNRIIEYADKNIQKEq-eTATRTLKQISKL 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XDO_A        83 VLKADQEFDGLYNE-LLLEMARNQIFLINERQLSVNQQNWLRHYFKQYLRQHITPILI-NPDTdLVQFLKDDYTYLAVEI 160
gi 692528511  88 AHEMVKRQYNTLNRsLLPLLEQHAIHLLSMADLNEEQHAFVKNYFDDELYPALTPMAD-DSSR-PFPFIGNNTLNIALRI 165
gi 499998433  89 AGEQIKNQYQVLNRsIIPTMKKLGFSLVHKNDLTNAQVNFLKKFFEKELRPVLTPMAI-DSTR-PFPFLANDTLNIGVRL 166
gi 499536700  84 VLKMNQDFDTLYNE-ILLEMARRHIFLVNDLQLDVNQQNWLRRYFHDSILPHITPILLtDDIE-LLQFLKDEYSYLAIEM 161
gi 500025913  84 VMALGEAFDNTYKE-LLIALARHNIFLVNEYQLSESIQQWLRVFFKEKVLRHIIPILL-NKEVnPVKFLKDEYTYLAIEM 161
gi 447194316  84 ALKLNQDFDNLYNE-LILEMARRRIFLVNETQLDEIQLKWVKKYFHKEVLPHVTPIML-RDDIdVMQFLKDEYAYIAVEM 161
gi 446167149  86 VLKADQEFDGLYNE-LLLEMARNQIFLINERQLSVNQQNWLRHYFKQYLRQHITPILI-NPDTdLVQFLKDDYTYLAVEI 163
gi 499945667  86 VMALQERFDSIYVE-LMRELVRRNILLINEKQLSEFHSNWLKKHFRDHFKRHIAPLIV-NNNRdLVKHINDDATYLCVCL 163
gi 499895324  88 VLGMTEDFERVRED-VVARLARYNIFLLENEKLSDYQTTWLKNYFKNKILRHIAPILL-HGKVnLVSRLNDSATYLYVAI 165
gi 499419851  91 HNRFYEQFEETFAS-IMEELKKENICVIKDTEMTDDQKTFITSFYRNKLNGSTTPLFL-NGAR-PLDDQTDEDIYLAIRL 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XDO_A       161 IR----GDT--IRYALLEIP-SdKVPRFVNLPPEAP-R-RrK-PMILLDNILRYCLDDIFKGffdY---DALNAYSMKMT 227
gi 692528511 166 YKng-dKKD--RKFATVQVP-D-VFPRVVVLPGAP------N-QFILIEEIIKAFVGSLFIN---Y---TVKETSCYRVM 227
gi 499998433 167 KKnd-eKSE--KYIAVLQVP-E-TSGRVIALPEE-------N-QVILVEDVVQLFLDALFPG---Y---TIKESNVFHIL 227
gi 499536700 162 QQ----GEK--KRHALIEIPtD-QLPRFIELPEPKG-K-R-KkTLILLDNIIRFCLDDIFNGffeY---DSLAAYSMKMT 228
gi 500025913 162 KKn---GQV--IQYALVEVPtD-DLPRFFQLPPEGT-R-R-KkQIIILDNVIRFCLDEIFKGffdY---DEIAAYAVKLT 229
gi 447194316 162 r----sGDE--FKYALIEIPtD-QLPRFVMLPEQKG-K-RrK-TIILLDNIIRLCLDEIFRGfydY---DTLNGYAMKMT 228
gi 446167149 164 IR----GDT--IRYALLEIPsD-KVPRFVNLPPEAP-R-RrK-PMILLDNILRYCLDDIFKGffdY---DALNAYSMKMT 230
gi 499945667 164 FTks------rRQYALVEVPtK-NVPRFIELPAEKS-KaK-K-YLILLDNIIRHCVDDLFGPffeY---EAIEVYSMKLT 230
gi 499895324 166 nn---sGKN--TQYATIEVP-SkALSRFVVIPPENSrK-K-K-YIILLDDIIRLNLESIFKG---FvdfESGEAYSFKMT 233
gi 499419851 168 LRkdetGKIkeKDYAVIELPtE-EYGRFIQLPDSEG-K---T-YLMFLDDVIRYCLPLIFVGm-kY---TDYEAYTFKFT 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XDO_A       228 RDAEYDL-VHEMEASLMELMSSSLKQRLTAEPVRFVYQRDMPNALVEVLREKLTISRYDSIVPGGRYhNFKDFINFPN-V 305
gi 692528511 228 RDLDLDV-AEEDTSDLLKEVQKQLKMRERGKVMRLEVEKSMSKHQRTRLAKALGINESALYVINGPL-NLTFLSKLVKaV 305
gi 499998433 228 RDMELDVaDDEDTPNILQEVQSKLQERERGRVIRVIVSANTGKMLMTQLIKALQVPDDRIYEVSGPI-DLTFISSWLKvI 306
gi 499536700 229 RDAEYDL-SQEVEHSLLEQMSEGLNQRITAMPVRFVYQRDMPGNMIDVLCGLLKVSRYDSIIPGGRYhNFKDFIGFPN-V 306
gi 500025913 230 RDAEYDL-SDQLDLSLVDKMSDGLKQRLTAMPVRFVYEREMPAAMISFLKLKLQISSYDAIMPGGRYhNFKDFIGFPN-V 307
gi 447194316 229 RDAEYDL-RHEVEYSLLEQMSEGLSQRLTALPVRFVYEREMPEAMLKFLCYKLKISHYDSLIPGGRYhNFKDFISFPN-V 306
gi 446167149 231 RDAEYDL-VHEMEASLMELMSSSLKQRLTAEPVRFVYQRDMPNALVEVLREKLTISRYDSIVPGGRYhNFKDFINFPN-V 308
gi 499945667 231 RDAEFDI-TDELEQTQLEKMTKGLKKRLTAEPVRLVYDKEMPEHMLEMLKENLNISSTECLIPGGRYhSFKDFIGFPNp- 308
gi 499895324 234 RDSEYSI-NDEIEESYVEKMSESMKQRLIAEPVRVVYDEQMPSDMVRNLKKRLKISSYDSLIAGGTYrNFKDFIGFPN-V 311
gi 499419851 238 KDAEMEI-DSDLRTGVLQKISKGVKSRKRGEPIRFVYDEQIPKDLLKRLVDRLNVDKNDTRVAGGRYhNFKDLMKFPV-C 315
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XDO_A       306 -GKANLVNKPLPRLRHIWFDkaQFRNGFDAIRERDVLLYYPYHTFEHVLELLRQASFDPSVLAIKINIYRVAKDSRIIDS 384
gi 692528511 306 qGHEDLNYPKYHAYYPAKYR--E-RSIFDLIKDHDILMQYPYDDFKPVVDFIHEAAEDEDVLAIKMTLYRVSADSPIIKY 382
gi 499998433 307 -DAPTLEYTSFHGYENPDLT---ADKIFESIRKRDYLLHHPYDSFKPVVQFIQTAAIDDDVLAIKMTLYRVSGNSPIIKA 382
gi 499536700 307 -GRKYLENASLPPIQSYHFT--QARNAFDAIKAQDILLYYPYHTFNHVTEFIRQASYDPKVRSIKINIYRVAKHSRVIDS 383
gi 500025913 308 -GRDYLENPKLPALDCRDFD--GFVNAFDAITKQDILLYYPYHKFHHFTELVRQAAFDPAVSAIRINIYRVAKKSRIIHS 384
gi 447194316 307 -GRDYLENKPLPPMTCADFE--GYANAFDAIRAQDILLHYPYHSFEHMTELVRQASFDPKVVSIKINIYRVAKDSKLMNS 383
gi 446167149 309 -GKANLVNKPLPRLRHIWFDkaQFRNGFDAIRERDVLLYYPYHTFEHVLELLRQASFDPSVLAIKINIYRVAKDSRIIDS 387
gi 499945667 309 -SRDYLENEKLPALNSSGFG--RSANSFDAIKMGDIMVNYPYHKFSHFTEMVRQAAYDPAVRFIRINLYRVAKKSHVMQS 385
gi 499895324 312 -GRDYLENPKLPAITSSDFA--RHNTVFDAISEKDILLYYPYHRFLHVTEFVRQAAFDPKVKQIKLNIYRVAKNSRIIDS 388
gi 499419851 316 -GRYDLKYPVWEPVFKPELN--GKESLLTLIRQKDRSLHYPFHSFDTFIRVLREAAISKEVKSIKMTLYRLAKESKVIKA 392
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XDO_A       385 MIHAAHNGKKVTVVVELQARFDEEANIHWAKRLTEAGVHVIFSAPGLKIHAKLFLISRKENGEVVRYAHIGTGNFNEKTA 464
gi 692528511 383 LGQAAQNGKQVTVLVEVKARFDEENNVHWAKKLEEMGCHVIYGLIGLKTHCKLALVVRRENEGIKRYMHMGTGNYNDVTA 462
gi 499998433 383 LSDAAQRGKQVTVLLEIKARFDEENNVHWARELEQKGVHVVYGLRGLKVHAKMAMVVRRESDTIRRYVHLATGNYNDVTA 462
gi 499536700 384 MIDAANNGKRVTVVVELQARFDEEANIEWARRLTEAGVHVVFGVPGLKIHSKLCLITRQEDDKLVRYAHIGTGNFNEKTA 463
gi 500025913 385 LIDAANNGKKVTVVVELRARFDEAANIDWANILTDAGVKVVFGVPSLKIHSKLCLITRHEQGEAVRYAHIGTGNFNEKTA 464
gi 447194316 384 LVDAVHNGKRVVVVVELQARFDEEANIEWSRILTDAGVHVIFGVPGMKIHAKLLLITRKEGDEFVRYAHIGTGNFHERTA 463
gi 446167149 388 MIHAAHNGKKVTVVVELQARFDEEANIHWAKRLTEAGVHVIFSAPGLKIHAKLFLISRKENGEVVRYAHIGTGNFNEKTA 467
gi 499945667 386 LIDAVKNGKQVTAVIELRARFDEQSNIEWTRVLAEAGVKVHHGITSLKVHSKLCLIGREEQGEMKLYCHVGSGNFNEGTA 465
gi 499895324 389 LIDAVDNGKKVTVVVELRARFDEEANIGWSKTMTDAGIKVVFGMHALKIHSKLCLVSREEKGELIHYAHFGTGNFNEKTA 468
gi 499419851 393 LICAAKNGKKVTVVIELLARFDEASNINWSKRMQDAGIHVIFGVEGLKIHSKLVHIGTRHGD----IACISTGNFHEGNA 468
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XDO_A       465 RLYTDYSLLTADARITNEVRRVFNFIENPYRPVTFDYLMVSPQNSRRLLYEMVDREIANAQQGLPSGITLKLNNLVDKGL 544
gi 692528511 463 HFYTDMGLFTADTDMGIDASNIFNMLSGYSEPPYFHKLHISPDGIRDFINEKLDDEIAIAKAGQPAVVKMKMNSLSDPQI 542
gi 499998433 463 NFYTDLGLLTVDSELGADVASIFNILTGYSDPSFFHQLHMSPNGIREFIYEKINVEIKNAKAGKPSGIKMKFNSLSDERM 542
gi 499536700 464 RIYTDFSLMTCNTEIADEVRQVFSYIQNPYRPVEFTHLIVSPRNSRSRLYDLIDREIAHAKQSLPSGITLKVNNLVDKGL 543
gi 500025913 465 KIYTDFSLLTRHPDITAEVEGVFEYIEYPYRRYKFNHLLVSPINSRRQLYRLIDNELANAKAGQPSGITLKINNLVDRDL 544
gi 447194316 464 RIYTDFALLTANQELAAEVRAVFGYIENPFRPVKFNHLIVSPRNSRTQIYRLLDSEIANAKAGKKAAITLKVNNLVDKGL 543
gi 446167149 468 RLYTDYSLLTADARITNEVRRVFNFIENPYRPVTFDYLMVSPQNSRRLLYEMVDREIANAQQGLPSGITLKLNNLVDKGL 547
gi 499945667 466 RVYTDLSLFTANQEIAREVEQVFDLIEHPYRRDNFQHLIVSPYDARQKLTHLIDNEIVNAQSHIKAAITLKLNNLLDESL 545
gi 499895324 469 KIYTDFSLFTRNQELALEAENVFNFIQQPYRRQKFQHLQISPINARTKIQLLIRQEIQNVKEGLSAGITLKLNNLDDQLL 548
gi 499419851 469 RMYTDYTIMTAHRPLVREVNAVFDFIEKPYTPVNFKELLVSPNDMRKRLIALISKEIKNKEQGKEAYILAKVNHITDRAL 548
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XDO_A       545 VDRLYAASSSGVPVNLLVRGMCSLIPNLEGISDNIRAISIVDRYLEHDRVYIFENGGDKKVYLSSADWMTRNIDYRIEVA 624
gi 692528511 543 ISKLYEASHAGVKIQLIIRGICCLRTGIKGISDNIEVHSIIGRLLEHSRIYYFSNDGEPQIYLSSADMMTRNLNRRVELL 622
gi 499998433 543 IRHLYEASEAGVPVELIVRGITMLKVGIPKVSETIAVHSIVGRFLEHSRVFIFHNDDSPQVYLSSADLMTRNLDRRVELL 622
gi 499536700 544 INMLYQASNNGVNIKLIVRGMCALIPGLKGISENITAISIVDRFLEHPRVAVFNNNNDPDVMISSADWMTRNIDNRIEVG 623
gi 500025913 545 INRLYAAGQAGVPIQMIIRGMCALRPGVPGLSENIRVISIIDRFLEHPRVMVFHNKGNPQLYISSADWMSRNIDGRIEVG 624
gi 447194316 544 INKLYGASAAGVKIRMIIRGMCSLVPGVEGVSDNIEIISIIDRFLEHPRVLVVHNDGNPQVFISSADWMERNIDHRIEVM 623
gi 446167149 548 VDRLYAASSSGVPVNLLVRGMCSLIPNLEGISDNIRAISIVDRYLEHDRVYIFENGGDKKVYLSSADWMTRNIDYRIEVA 627
gi 499945667 546 VQKLYEASAAGVKIKLLIRGMCSLIPQIPGISDNIEIYSIVDRFLEHSRVMLFHAGGENKLFISSADWMSRNIDNRVEVS 625
gi 499895324 549 IDDLYKASQAGVEVRLIIRGMCSLVPGVKGLSENISVISIVDRFLEHPRVMVFENAGEKRVFISSADWMTRNMDFRIEVG 628
gi 499419851 549 IEKLYEASTAGVQVELVVRGNCSLVTGIAGISENIHINGIIDRYLEHSRIFIFANGGEEKYYIGSADWMPRNLDNRIEVL 628
                        650       660       670       680       690
                 ....*....|....*....|....*....|....*....|....*....|....*...
1XDO_A       625 TPLLDPRLKQRVLDIIDILFSDTVKARYIDKELSNRYvPRGNRR---KVRAQLAIYDY 679
gi 692528511 623 FPLLQPEISHRAMTIFETMWADTVKTRILQPDNTYARvDGRGLE---VLDSQAEFIRE 677
gi 499998433 623 FPIRNAGLSQQVINIFEIMWADNVKTRVLQPDGSFDKiDRRGLS---SVNAQEMFIAE 677
gi 499536700 624 CLINDPALKKKIIDILNIQLTDTVKARILDKAMSNQYvPRGNRR---KIRSQIAIYDY 678
gi 500025913 625 TPIYDERLKQRILDILELQLSDTCKARVIDADQQNEYvKRGNRR---KIRSQVAIYDY 679
gi 447194316 624 APIRDERLKQRIIDILNIQFIDTVKARRIDKEMSNQYvERGNRR---KVRSQIAIYDY 678
gi 446167149 628 TPLLDPRLKQRVLDIIDILFSDTVKARYIDKELSNRYvPRGNRR---KVRAQLAIYDY 682
gi 499945667 626 VPIYDPRLKQMVMDILSLQFNDNTKARIINKEQSNPYrNRGNKR---KVRSQIAIYQY 680
gi 499895324 629 CPIYEPKLIKQILDILEIQFQDTLKARIIDQHQSNKYvRRGNRK---KLRSQIETYEY 683
gi 499419851 629 APVYDKEIQADLKRIVCYGYRDTAKGRIVDGTGENRPwENRPSTlckDFTPALAEAET 686
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap