Conserved Protein Domain Family
xanthine_xdhC

?
TIGR02964: xanthine_xdhC 
xanthine dehydrogenase accessory protein XdhC
Members of this protein family are the accessory protein XdhC for insertion of the molybdenum cofactor into the xanthine dehydrogenase large chain, XdhB, in bacteria. This protein is not part of the mature xanthine dehydrogenase. Xanthine dehydrogenase is an enzyme for purine catabolism, from other purines to xanthine to urate to further breakdown products. [Protein fate, Protein folding and stabilization, Purines, pyrimidines, nucleosides, and nucleotides, Other]
Statistics
?
PSSM-Id: 274366
View PSSM: TIGR02964
Aligned: 18 rows
Threshold Bit Score: 283.809
Threshold Setting Gi: 20520974
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

TIGR02964 is classified as a model that may span more than one domain.
TIGR02964 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6460487    16 VLVTLAVVRGHAPREAGAKMVVSVTQTWDTVGGGNLEATAVARARALLETGASAPELLTLRLTDRAPneygrQCCGGEVT 95
gi 20520974   18 VLVTVATVRGHAPRDAGAKLVVGRTGTWGSIGGGNVEAVAVDRAREMIAAAAPEPEMLDFALNDKVTnrhgvQCCGGTVA 97
gi 9947479    18 VLVTIIEERGSTPRNAGSKMVVSAERLYDTIGGGHLEYRAQAIAREMLAARTQDTRLERFSLGASLG-----QCCGGATV 92
gi 63255764   19 ILVTIIEELGSTPRNAGSKMVVCAEHIHDTIGGGHLEYKAMEIAREMLASGTRQTRLERFNLGASLG-----QCCGGVNV 93
gi 58001535   16 VRLTVIRARGSTPREEGAFMLLTPSEQTGTIGGGRLEWDCMAEGRALLAAGGAPVERH-IPLGPAIN-----QCCGGAVT 89
gi 17740790   23 ILVEIEAVKGSSPREAGTFMLVSQEALWETIGGGQFEYMAIDHARAMLRTGAAEDRMD-IPLGPEIG-----QCCGGRTL 96
gi 17983588   24 VLVEVTDVKGSAPRDAGAWMLVARDTIFRTIGGGQLEYMAIEHARKILSGGR-DTPLD-VPLGPEIG-----QCCGGRVS 96
gi 499282588  21 VLVEVASAAGSTPRDADAWMLVSKDRTFSTIGGGQLEFMAIDHARKLVQGANADLRLA-IPLGPEIG-----QCCGGHVA 94
gi 499358093  19 TRVVIAAIRGSSPREVGAAMLVWENGQSGTIGGGALEFQAAEAARA-GR-----LGLSRHALGPELG-----QCCGGAVT 87
gi 502831558  18 VRVLVVETRGSTPREVGAEMRVWPDHTQGTIGGGTLEAEAITIARGLTA-----PALRRFPLGPALG-----QCCGGAVT 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6460487    96 LLLEPLr------------------------------------------------------------------TAFPVVA 109
gi 20520974   98 VLLEPL-------------------------------------------------------------------PVVRAVA 110
gi 9947479    93 LLFEPMg------------------------------------------------------------------QPQAHIA 106
gi 63255764   94 LLFEPMg------------------------------------------------------------------EPVAQIA 107
gi 58001535   90 VRIERVqdaeale-----------------------------------------------------aeiraewERLPQLL 116
gi 17740790   97 IRFRLItaeiaatl---------------------------------------------------earlkgeaEQQPAVF 125
gi 17983588   97 LSFRLMthgladel---------------------------------------------------vgkvdteiAMRPHVY 125
gi 499282588  95 LSFKKVdadtraal---------------------------------------------------iersddeiAHRPHVY 123
gi 499358093  88 LLTESWdaarldtvegtvvarpalpfsgtengpetlqvsgaplalrrllaqargqgvlpkaqlvgdwmvepvlRPARQLW 167
gi 502831558  88 LAFEPLdaesltriagpfharpltgpdmplavq--------------ralslarnsgqrppllldgwlierlaPPAQELW 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6460487   110 LFGIGHVGLELGLLLSRHP-VELHLADSRAAQL-------------------TPERLaplrGGPARLHVHhs-pIPEMAL 168
gi 20520974  111 VFGVGHVGLELARILARQD-IDLHLVDSRAELL-------------------TEERLgvlsDAVAQVHTHhtplLPEEVL 170
gi 9947479   107 VFGAGHVGRALVPLLASLP-CRVRWIDSREHEF-------------------PALLP----DGVEKVVND----EVLDEV 158
gi 63255764  108 VFGAGHVGRALVPLLASLP-CRVRWIDSREQEF-------------------PEQMP----EGVTKIISD----EPVDEV 159
gi 58001535  117 LFGAGHVGRALARSLALLP-LRLVWVDAREEEF--------------------GTVP----PGVEAHVTE----QWESLV 167
gi 17740790  126 IFGAGHVGKALADALSLLP-LTLKVVETRESEL--------------------RDIP----AGIASILTP----MPEAFV 176
gi 17983588  126 IFGAGHVGGALARALSLTP-VRVIMVDTREAELmkfqekwepvfrpgfhgnyICDVP-----GVETCLSA----IPEQAV 195
gi 499282588 124 IFGAGHVGNALAMALSHVP-LRTVLVDTREHELs------------------AADVP-----GIETCLTA----MPEATV 175
gi 499358093 168 IWGAGHVGRALVDVLSPLPeIAITWVDTGVERF-------------------PETIP----AGVTPLPAA----QPADLV 220
gi 502831558 154 IWGAGHVGRALVATLAPLPhWSIRWADFDESRF-------------------PEPIP----ETVMPVIAE----NPADLV 206
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6460487   169 AELPPGACAVFLTHDHAEDLALCDAALHRGDLAFTGLIGSAVKWSRFREQLRAAGHTPEA-IKTITCPVGLPGLGGKAPA 247
gi 20520974  171 AELPPGTHVLIMTHDHAEDAALCDAALRTDHLGSIGLIGSAAKWARFRKRLAGEGDHDDAlIDRIKTPIGLADITGKEPA 250
gi 9947479   159 ERMPPGSHFIVMTHNHPLDLELTAAILARNDFAYFGLIGSKTKRVKFEHRLRERGVDAER-LQRMRCPMGLEQVKGKLPA 237
gi 63255764  160 AQLPVGTYCIVMTHNHQLDLELTAAILTRGDFGYFGLIGSKTKRVKFEHRLRERGFDASL-LQRMRCPMGLAEVKGKLPI 238
gi 58001535  168 QGAPAGSGVLVLTQSHTLDALITGAALERGDLRYVGMIGSRTKRKRFESAFRQIDVPQER-IDRLVCPIGDFGARDKRPE 246
gi 17740790  177 QKIPANGAAIIVTHDHALDFLIAKEALARDDLAYVGMIGSKTKRATFAHWLEREGEPPSR-LAKLTLPIGGTGVRDKRPA 255
gi 17983588  196 RSAPPHSAFIILTHDHALDFLIAAEALQRQDAAYVGMIGSKTKKATFKNWLKREAGREDL-FENLVCPIGGAVVKDKRPE 274
gi 499282588 176 RDAPPDSAFVVLTHDHALDFLIATEALGREDASYVGMIGSKTKRATFKNWLSREVDRPEL-FGRLVCPIGGTAVKDKRPP 254
gi 499358093 221 GYAPKEAEHLILTYSHELDLELCNRLL-RHDFAFAGLIGSATKWARFRSRLAALGHGPQQ-IARITCPIGDPAL-GKHPA 297
gi 502831558 207 PLAAASAHHLILTYSHALDLELCHRIL-RHGFAACGLIGSQTKWSRFQRRLRDLGHAHAQ-ISRIACPIGDPRL-GKEPQ 283
                        330
                 ....*....|.
gi 6460487   248 VIALSIAAQLY 258
gi 20520974  251 TIAVSVAADLL 261
gi 9947479   238 EIAISIAGEVI 248
gi 63255764  239 EIAVSIAAEII 249
gi 58001535  247 VIATFVTAEIA 257
gi 17740790  256 VIAALVAAELL 266
gi 17983588  275 VIAALAAAEIL 285
gi 499282588 255 VIAALAAAEIL 265
gi 499358093 298 SIAIGVAARLL 308
gi 502831558 284 AIAISVAAALL 294
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap