Conserved Protein Domain Family
P-ATPase-V

?
TIGR01657: P-ATPase-V 
P-type ATPase of unknown pump specificity (type V)
These P-type ATPases form a distinct clade but the substrate of their pumping activity has yet to be determined. This clade has been designated type V in.
Statistics
?
PSSM-Id: 273738
View PSSM: TIGR01657
Aligned: 9 rows
Threshold Bit Score: 1265.36
Threshold Setting Gi: 6707671
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

TIGR01657 is a member of the superfamily cl27747.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012   307 DLVIGIAAYQTSKFWYIIYNLCCFLTFGLVYLLTRWLPHLKVKLYGVKVPLAKAEWVVIENe-------------fGEFV 373
gi 12229714   36 TVWLTTIVPSIDFSDACIALGGLSAFHILVLLFTTWSVDFKCFVQFSKVNSIDQADACKVTp--------------AKFS 101
gi 18202961   85 GCWGWGSSWVQIPEAALLVLATICLAHALTVLSGHWSVHAHCALTCTPEYDPSKATFVKVVp--------------TPNN 150
gi 731415     42 LYFQQYDRYIKGPEWTFVYLGTLVSLNILVMLMPAWNVKIKAKFNYSTTKNVNEATHILIYt--------------TPNN 107
gi 19700788   14 EDEMEIYGYNLSRWKLAIVSLGVICSDGFLLLLLYWMPEWRVKATCVRAAIKDCEVVLLRTtdefkm---wfcakiRVLS 90
gi 14285364   32 VSSVRLSGYCGSPWRVIGYHVVVWMMAGIPLLLFRWKPLWGVRLRLRPCNLAHAETLVIEIrdkedsswqlftvqvQTEA 111
gi 30581066    7 DHTLTLFAYRTGPFRTILFYALTVLTLGIFRLILHWKQKWDVKMRMVPCTFEAAEYIYIIDnhnvs-------elqpVLR 79
gi 6707665    33 EETIGIKPFKSIPAKVYILRVTEILTLGLLHLILTWLPEFRLKWIEAPCSNEDVEFVAISDp-----------------S 95
gi 6707671    17 DKTDVEGELKIKQVTLLRENIVKKIVFFLVAIFCSDRPSVLKKVFYEEVSKQEEATHVYVLa----------------sD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012   374 IQPIDRQWYNRPLSTvlpfENYPNPSYEPNDINLSHHHANEiNPNVPilitfe---yryikfIYSPLDDLFKTNnnwiDP 450
gi 12229714  102 GSKEVVPLHFRSQMT----DSASSGDMEEIFFDFRKQRFIY-SKELG---------------AFSKLPYPTKET----FG 157
gi 18202961  151 GSTELVALHR---------N-EGEDGLEVLSFEFQKIKYSYdALEKK---------------QFLPVAFPVGNA----FS 201
gi 731415    108 GSDGIVEIQR-----------VTEAGSLQTFFQFQKKRFLWhENEQ----------------VFSSPKFLVDESp--kIG 158
gi 19700788   91 LETYPVS-SPKSMSNklsnGHAVCLIENPTEENRHRISKYSqTESQQiryfth----hsvkyFWNDTIHNFDFLkgldEG 165
gi 14285364  112 IGEGSLEPSPQSQAEdgrsQAAVGAVPEGAWKDTAQLHKSEeAVSVGqkrvlryylfqgqryIWIETQQAFYQVslldHG 191
gi 30581066   80 KSNATIPTENGEMRKvpelRWFVYRKLEYVWIDDLNSDESVdEISDNd-------------nCWKTSFEIANRIp----C 142
gi 6707665    96 GTSSIEKVSSICLKNdiqtSSFVLPSGKTRYFEYKKLRFYLePLNLQ----------------WVLMPLETSAYs----L 155
gi 6707671    81 LTDYIEEASLK--------ENPEEGGEKSIYFVNRLQKYIYhKKQNK----------------FRAIEYFIQGK------ 130
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012   451 DWVDLSTVSNgl--tKGVQEDRELAFGKNQINLRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFLISVLS 528
gi 12229714  158 HYLKCTGHGT-----EAKIATATEKWGRNVFDYPQPTFQKLMKENCMEPFFVFQVFCVGLWCLDEFWYYSVFTLFMLFMF 232
gi 18202961  202 YYQSNRGFQE-----DSEIRAAEKKFGSNKAEMVVPDFSELFKERATAPFFVFQVFCVGLWCLDEYWYYSVFTLSMLVAF 276
gi 731415    159 DFQKCKGHS-------GDLTHLKRLYGENSFDIPIPTFMELFKEHAVAPLFVFQVFCVALWLLDEFWYYSLFNLFMIISM 231
gi 19700788  166 VSCTSIYEKHsagltKGMHAYRKLLYGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSTDEYYYYALAIVVMSIVS 245
gi 14285364  192 RSCDDVHRSRhg-lsLQDQMVRKAIYGPNVISIPVKSYPQLLVDEALNPYYGFQAFSIALWLADHYYWYALCIFLISSIS 270
gi 30581066  143 RSLLAVSESNfg-ltLSEISRRLEFYGRNEIVVQLRPILYLLVMEVITPFYVFQIFSVTVWYNDEYAYYASLIVILSLGS 221
gi 6707665   156 VTSTPAYIQNgl--dTFTIAKLRQVYGSNSLVSTKKSIVTILLNEVLHPFYLFQAVSVLIWLCDSFVFYSCCIVFISSYS 233
gi 6707671   131 SYSEIANNKPl---aTGRVDQLLAYYGKSEIEINVPSFLTLMWREFKKPINFLLYFGIIVWGIEQMYVSTAITVVFTTTI 207
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012   529 IFDSLNEQKKVSRNLAEMSHFH--CDVRVLRDK----FWTTISSSELVPGDIYEVSDP------NITILPCDSILLSSDC 596
gi 12229714  233 ESTMAKSRLKTLTDLRSVRVDS--QTVMVYRSG----KWVKLLGTDLLPGDVVSIGRPstqtggEDKTVPADMLLLVGSA 306
gi 18202961  277 EASLVQQQMRNMSEIRKMGNKP--HMIQVYRSR----KWRPIASDEIVPGDIVSIGRSp-----QENLVPCDVLLLRGRC 345
gi 731415    232 EAAAVFQRLTALKEFRTMGIKP--YTINVFRNK----KWVALQTNELLPMDLVSITRTa-----EESAIPCDLILLDGSA 300
gi 19700788  246 IVSSLYSIRKQYVMLHDMVATHstVRVSVCRVNe---EIEEIFSTDLVPGDVMVIP-L------NGTIMPCDAVLINGTC 315
gi 14285364  271 ICLSLYKTRKQSQTLRDMVKLS--MRVCVCRPGg---EEEWVDSSELVPGDCLVLP-Q------EGGLMPCDAALVAGEC 338
gi 30581066  222 IVMDVYQIRTQEIRLRSMVHST--ESVEVIREG----TEMTIGSDQLVPGDILLIP-P------HGCLMQCDSVLMNGTV 288
gi 6707665   234 IFLSVKESKESENRIHSIIGAP--QPVTVIRNQ----VKQTVLADDLVIGDLLYFSNL------DLKTCPVDGILFSSSC 301
gi 6707671   208 NSLICIYIRGVMQKLKDACLNN--TSVIVQRHNgqgyQEITVASNMIAPGDIVLFK--------REVTLPFDCVILEGSC 277
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012   597 IVNESMLTGESVPVSKFPATEetmyqlCDDFQSTQISSFvSKSFLYNGTNIIRARIAPg--------QTAALAMVVRTGF 668
gi 12229714  307 IVNEAILTGESTPQWKVPIVG------QRSDEKLSIKRN-KNHVLFGGTKILQHSPDKsfsl--ktpDGGCLAVVLRTGF 377
gi 18202961  346 IVDEAMLTGESVPQMKEPIED------LSPDRVLDLQADsRLHVIFGGTKVVQHIPPQkattglkpvDSGCVAYVLRTGF 419
gi 731415    301 IVNEAMLSGESTPLLKESIKL------RPSEDNLQLDGVdKIAVLHGGTKALQVTPPEhksdippppDGGALAIVTKTGF 374
gi 19700788  316 IVNESMLTGESVPVTKTNLPNpsvdvkGIGDE-LYNPEThKRHTLFCGTTVIQTRFYTg--------E-LVKAIVVRTGF 385
gi 14285364  339 MVNESSLTGESIPVLKTALPe------GLG---PYCAEThRRHTLFCGTLILQARAYVg--------P-HVLAVVTRTGF 400
gi 30581066  289 IVNESVLTGESVPITKVALTd------ETNDS-VFNIEKnSKNVLFCGTQVLQTRFYRg--------K-KVKAIVLRTAY 352
gi 6707665   302 LLDESMVTGESVPARKFPLEDn-----SLDSWMIASCNIfSPHLIHAGTKFLKIDSTP---------STPCLISVVRTGF 367
gi 6707671   278 QVTEANITGENVAIGKCQIP-------TDHHNDIFKYESsKSHTLFQGTQLMKIEDDI------------LKVIVVRTGF 338
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012   669 STTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLG-LDKKTMILRALDIITIVVPPALPATLTI 747
gi 12229714  378 ETSQGKLMRTILFSTERVTANSWESGLFILFLVVFAVIAAGYVLVKGLEDPtRSKYKLLLGCSLIITSVIPPELPMELSI 457
gi 18202961  420 NTSQGKLLRTILFGVKRVTANNLETFIFILFLLVFAIAAAAYVWIEGTKDPsRNRYKLFLECTLILTSVVPPELPIELSL 499
gi 731415    375 ETSQGSLVRVMIYSAERVSVDNKEALMFILFLLIFAVIASWYVWVEGTKMG-RIQSKLILDCILIITSVVPPELPMELTM 453
gi 19700788  386 STSKGQLVRSILYPKPTDFKLYRDAYLFLLCLVAVAGIGFIYTIINSILNE-VQVGVIIIESLDIITITVPPALPAAMTA 464
gi 14285364  401 CTAKGGLVSSILHPRPINFKFYKHSMKFVAALSVLALLGTIYSIFILYRNR-VPLNEIVIRALDLVTVVVPPALPAAMTV 479
gi 30581066  353 STLKGQLVRSIMYPKPVDFRFTKDLFKFILFLACISGCGFIYTIIVMIMRG-NTLRRIIVRSLDIITITVPPALPAAMSV 431
gi 6707665   368 RSNKGQLIRNLLYPNLRPSQLYLDSMSFLKTMAILSFVSIVFIAIYLNLYN-ASFGHVVLRSLDVLTILVPPALPATLSV 446
gi 6707671   339 GSYKGQIIRALLYPKPFNKKFQQQAVKLTILMATLLLIGFLSTLSRLLDIE-LPPLFIAFRFLDILIYSAPPGMPMLIAI 417
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012   748 GTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVrgqkfgellsdirqvfpkFSLND 827
gi 12229714  458 AVNTSLLALVRRGIFCTEPFRIPFAGKVDLCCFDKTGTLTSDDMEFRGVGGLSNCEE------------------AETDM 519
gi 18202961  500 AVNTSLIALAKLYMYCTEPFRIPFAGKVEVCCFDKTGTLTSDSLVVRGVAGLRDGKE-------------------VTPV 560
gi 731415    454 AVNSSLAALAKFYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEGLAGISADSEni---------------rHLYSA 518
gi 19700788  465 GIVYAQRRLKKIGIFCISPQRINICGQLNLVCFDKTGTLTEDGLDLWGIQRVENARfl----------------sPEENV 528
gi 14285364  480 CTLYAQSRLRRQGIFCIHPLRINLGGKLQLVCFDKTGTLTEDGLDVMGVVPLKGQAfl----------------pLVPEP 543
gi 30581066  432 GIINAQLRLKKKEIFCISPSTINTCGAINVVCFDKTGTLTEDGLDFHVVRPVMSAVNqeiqkvkleksnrtefmgEMTEL 511
gi 6707665   447 GIANSIARLSRALIYTTSPESIHNAGCLSTFVFDKTGTLTENSVQLSCVYVKSGSNGll---------------kQVDAD 511
gi 6707671   418 TNFVGLKRLKNNQILGQDPNSASQAGRIQTLCFDKTGTLTEDKVDLIGYQLKGQNQTfd---------------kIQCQD 482
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012   828 CsspldFKSRNFFMSLLTCHSLRSVDG-NLLGDPLDFKMFQFTGWSFEEdfqkrafhslyegrhedDVFPENSEIIpavv 906
gi 12229714  520 S-----KVPVRTLEILASCHALVFVEN-KLVGDPLEKAALKGIDWSYKA-----------------DEKALPRRGN---- 572
gi 18202961  561 S-----SIPVETHRALASCHSLMQLDDgTLVGDPLEKAMLTAVDWTLTK-----------------DEKVFPRSIK---- 614
gi 731415    519 A-----EAPESTILVIGAAHALVKLEDgDIVGDPMEKATLKAVGWAVER-----------------KNSNYREG------ 570
gi 19700788  529 Cne--mLVKSQFVACMATCHSLTKIEG-VLSGDPLDLKMFEAIGWILEEat--------------eEETALHNRIMptvv 591
gi 14285364  544 Rr----LPVGPLLRALATCHALSRLQD-TPVGDPMDLKMVESTGWVLEEep--------------aADSAFGTQVLavmr 604
gi 30581066  512 TsrnglPFDGDLVKAIATCHSLTRING-VLHGDPLDLILFQKTGWTMEEgi--------------eGDIEEETQRFdnvq 576
gi 6707665   512 SlsldsTKLNAHAYRVATCSQSLELVGnELVGDPLEVTLFTQFNGTFCAt---------------iRASNTPHPPLfsvs 576
gi 6707671   483 P-----NNISIEHKLFSICHEVTKINN-KLLGDLMDVKMAEFSTLDIDYd----------------HEAKQHYSKS---- 536
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012   907 hpdsnn---------rentftdndPhNFLGVVRSFEFLSELRRMSVIVKTNNDdvy----wsFTKGAPEVISEICNksTL 973
gi 12229714  573 ------------------------G-NSVQIMQRYHFASHLKRMSVIVRIQEEyl------aFVKGAPETIQERLV--DV 619
gi 18202961  615 ------------------------T-QGLKIHQRFHFASALKRMSVLASYEKLgstdlcyiaAVKGAPETLHSMFS--QC 667
gi 731415    571 ------------------------T-GKLDIIRRFQFSSALKRSASIASHNDAlf------aAVKGAPETIRERLS--DI 617
gi 19700788  592 rppkqllpestpagnqemelfelpAtYEIGIVRQFPFSSALQRMSVVARVLGDrkm----daYMKGAPEAIAGLCKpeTV 667
gi 14285364  605 pplwe----------pqlqameepP-VPVSVLHRFPFSSALQRMSVVVAWPGAtqp----eaYVKGSPELVAGLCNpeTV 669
gi 30581066  577 psi--------------ikptddkS-AEYSVIRQFTFSSSLQRMSVIVFDPREdrpd-nmmlYSKGSPEMILSLCDpnTV 640
gi 6707665   577 n-------------------sfdgPsQIFSIYKALEFDPVLRRMSVICSTSTErsl----mlFTKGAPESILAISSqqSI 633
gi 6707671   537 ------------------------GnKRFYCIQVNQFHSEYQSMSVVCKEVDMitkefkhyfFIKGSPEKIQSLSH---V 589
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012   974 PADFEEVLRCYTHNGYRVIACAGKTLP-KRTWLYSQKVSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMC 1052
gi 12229714  620 PAQYIETYKRYTRQGSRVLALAYKRLP-DMMVSEARDMDRDAVESDLTFAGFAVFNCPIRPDSAPVLLELKNSSHDLVMI 698
gi 18202961  668 PPDYHHIHTEISREGARVLALGYKELG-HLTHQQAREVKREALECSLKFVGFIVVSCPLKADSKAVIREIQNASHRVVMI 746
gi 731415    618 PKNYDEIYKSFTRSGSRVLALASKSLP-KMSQSKIDDLNRDDVESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMI 696
gi 19700788  668 PVDFQNVLEDFTKQGFRVIALAHRKLEsKLTWHKVQNISRDAIENNMDFMGLIIMQNKLKQETPAVLEDLHKANIRTVMV 747
gi 14285364  670 PTDFAQMLQSYTAAGYRVVALASKPLPtVPSLEAAQQLTRDTVEGDLSLLGLLVMRNLLKPQTTPVIQALRRTRIRAVMV 749
gi 30581066  641 PEDYLLQVNSYAQHGFRLIAVARRPLD--LNFNKASKVKRDAVECDLEMLGLIVMENRVKPVTLGVINQLNRANIRTVMV 718
gi 6707665   634 PSNVQEVIHTLSSKGFRIIAFASKNLIt--PLQELIHLSRSTLESNVTFQGLFVLESPLRESSKDVISSLLRSKMEVSIC 711
gi 6707671   590 QSSEKAQLSTLINEGYRILGFGYKEIP-QSEIDAFLDLSREQQEANVQSLGFLIYKNNLKPDTQEVIKEFKEACYNIKVI 668
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012  1053 TGDNILTAISVGREAGLIQCSrVYVPSIndtplHGEPVIVWRDVNEPdki------------------------------ 1102
gi 12229714  699 TGDQALTACHVAGQVHIVSNP-VLILGR-----SGSGNEYKWVSPDE--------------------------------- 739
gi 18202961  747 TGDNPLTACHVAQELHFIEKAhTLILQPp----SEKGRQCEWRSIDG--------------------------------- 789
gi 731415    697 TGDNPLTAVHVAKEVGIVFGE-TLILDRa---gKSDDNQLLFRDVEE--------------------------------- 739
gi 19700788  748 TGDSMLTAVSVARDCGMILPQdKVIIAEalppkDGKVAKINWHYADSltqcsh--------------------------p 801
gi 14285364  750 TGDNLQTAVTVARGCGMVAPQeHLIIVHathpeRGQPASLEFLPMESpta------------------------------ 799
gi 30581066  719 TGDNLLTGLSVARECGIIRPSkRAFLVEhvpgeLDEYGRTKIFVKQSvsssdevieddasvsismcsstwkgssegdgfs 798
gi 6707665   712 SGDSLFTSVFVAKHCGALDSCnFIYTAEla-dsGDDCPQIHFEKIDLq-------------------------------- 758
gi 6707671   669 SGDNPITTLKISQELEIVNRKnPTVIINfeeteNVKSHLIITEIQPDnstqvi--------------------------d 722
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012  1103 -ldtKTLKPVKLGnn-sVESLRECNYTLAVSGDVFRLLFRDEnei------------------peeYLNEILLNSSIYAR 1162
gi 12229714  740 ----KEIIPYSEK----EIETLAETHDLCIGGDSIEMLQATS------------------------AVLRVIPFVKVFAR 787
gi 18202961  790 ----SIVLPLARG----SPKALALEYALCLTGDGLAHLQATDp----------------------qQLLRLIPHVQVFAR 839
gi 731415    740 ----TVSIPFDPSkdtfDHSKLFDRYDIAVTGYALNALEGHS------------------------QLRDLLRHTWVYAR 791
gi 19700788  802 saidPEAIPVKLVhd-sLEDLQMTRYHFAMNGKSFSVILEHFq----------------------dLVPKLMLHGTVFAR 858
gi 14285364  800 --vnGVKDPDQAAsy-tVEPDPRSR-HLALSGPTFGIIVKHFp----------------------kLLPKVLVQGTVFAR 853
gi 30581066  799 ptntEVETPNPVTad-sLGHLIASSYHLAISGPTFAVIVHEYp----------------------eLVDQLCSVCDVFAR 855
gi 6707665   759 ---tQNFQPIPDGfs-lKDVILEKDSSLCMDGKLLQRLLTMLsf---------------------nEIKILLSKLRVLAR 813
gi 6707671   723 fssaQNEQDYINKqmsyCCDAFLNNKSFCFSGKAHYYFQLKAktdhisfkpewvkmqdksvqkiisFYQMLIINTNVFAR 802
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012  1163 MSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEA----------------------------------- 1207
gi 12229714  788 VAPQQKELILTTFKAVGRGTLMCGDGTNDVGALKQAHVGVALLNNklplspsdsskddkskskksklplepasktitqng 867
gi 18202961  840 VAPKQKEFVITSLKELGYVTLMCGDGTNDVGALKHADVGVALLANapervverrrrprdsptlsnsgiratsrtakqrs- 918
gi 731415    792 VSPSQKEFLLNTLKDMGYQTLMCGDGTNDVGALKQAHVGIALLNGteeglkklgeqrrlegmkmmyikqtefmarwnqpq 871
gi 19700788  859 MAPDQKTQLIEALQNVDYFVGMCGDGANDCGALKRAHGGISLSEL----------------------------------- 903
gi 14285364  854 MAPEQKTELVCELQKLQYCVGMCGDGANDCGALKAADVGISLSQA----------------------------------- 898
gi 30581066  856 MAPDQKQSLVEQLQQIDYTVAMCGDGANDCAALKAAHAGISLSDA----------------------------------- 900
gi 6707665   814 MSPFDKATYVELCQKYGCKVGFCGDGANDCIALKQADVGVSLSDS----------------------------------- 858
gi 6707671   803 TQPEQKQTIVRLLKESDQIVCMVGDGANDCSAIREADVGISFAEA----------------------------------- 847
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012       --------------------------------------------------------------------------------
gi 12229714  868 egsskgk-------------------------------------ippqnrhltaaelqrqklkkimddlnndegdgrsap 910
gi 18202961  919 ---------------------------------------------------glppseeqptsqrdrlsqvlrdledestp 947
gi 731415    872 ppvpepiahlfppgpknphylkaleskgtvitpeirkaveeanskpvevikpnglsekkpadlaslllnsagdaqgdeap 951
gi 19700788      --------------------------------------------------------------------------------
gi 14285364      --------------------------------------------------------------------------------
gi 30581066      --------------------------------------------------------------------------------
gi 6707665       --------------------------------------------------------------------------------
gi 6707671       --------------------------------------------------------------------------------
                       1130      1140      1150      1160      1170      1180      1190      1200
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012  1208 -----EASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYSAIQFITITILYSRGSNLGDFQfLYIDLLL-IV 1281
gi 12229714  911 lvklgDASMASPFTAKHASVAPVTDIIRQGRSTLVTTLQMFKILGLNCLATAYVLSVMYLDGVKLGDVQ-ATISGVL-TA 988
gi 18202961  948 ivklgDASIAAPFTSKLSSIQCICHVIKQGRCTLVTTLQMFKILALNALILAYSQSVLYLEGVKFSDFQ-ATLQGLL-LA 1025
gi 731415    952 alklgDASCAAPFTSKLANVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYMAGVKFGDGQ-ATVSGLL-LS 1029
gi 19700788  904 -----EASVASPFTSKTPSISCVPNLIREGRAALITSFCVFKFMALYSIIQYFSVTLLYSILSNLGDFQfLFIDLAI-IL 977
gi 14285364  899 -----EASVVSPFTSSMASIECVPMVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGDLQfLAIDLVI-TT 972
gi 30581066  901 -----EASIAAPFTSKVPDIRCVPTVISEGRAALVTSFGIFKYMAGYSLTQFVTVMHLYWISNILTDGQfMYIDMFL-IT 974
gi 6707665   859 -----EACAAASFVSKKKSIKDVFNVLLEGRCSLILSHRCFQYMVLCAIVQFSGVFFLYLKNYNFNDNQfLFMDLLI-IF 932
gi 6707671   848 -----DGQFSSSYVSLSTSLSCVKRVLLEGRVNLSNSVEIFKGYLQVALLRYLGFLTLAYFYSSYSSGQmDWQALASgYF 922
                       1210      1220      1230      1240      1250      1260      1270      1280
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012  1282 PIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLISVFLVFLFQFIPWIIVQKMSWyikPIVg----------------- 1344
gi 12229714  989 AFFLFISHARPLQTLSAERPHPSVFSVYLFLSLIGQFAVHLTFLVYSVKEAEKHMP---EECie---------------- 1049
gi 18202961 1026 GCFLFISRSKPLKTLSRERPLPNIFNLYTILTVMLQFFVHFLSLVYLYREAQARSPekqEQFvd---------------- 1089
gi 731415   1030 VCFLSISRGKPLEKLSKQRPQSGIFNVYIMGSILSQFAVHIATLVYITTEIYKLEPr--EPQvd---------------- 1091
gi 19700788  978 VVVFTMSLNPAWKELVAQRPPSGLISGALLFSVLSQIIICIGFQSLGFFWVKQQPWyevWHPksdacnttgsgfwnsshv 1057
gi 14285364  973 TVAVLMSRTGPALVLGRVRPPGALLSVPVLSSLLLQMVLVTGVQLGGYFLTLAQPWfvpLNrt----------------- 1035
gi 30581066  975 MFALLFGNTPAFYRLAHTPPPTRLLSIASMTSVVGQLIIIGVVQFIVFFSTSQQPWftpYQPpv---------------- 1038
gi 6707665   933 PLSAAMSYFDPAQNLTSNRPNSTLFGKGRVKDLGIQSVLIWLSHGLLTLILHELNWvelPEWq----------------- 995
gi 6707671   923 LVYLILGCNTPLKKLEKSVFDDNLFSIYNVTSVLFGFTLHILSIVGCVESLHASPIykeVNSld---------------- 986
                       1290      1300      1310      1320      1330      1340      1350      1360
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493012  1345 ------GDDAVQSSDNTVLFFVSNFQYILTAIVLSVGPPYREPMSKNFEFIVDIT----VsIGASLLLMTLDTESYLGKM 1414
gi 12229714 1050 -----pDASFHPNLVNTVSYMVSMMLQVATFAVNYMGHPFNQSIRENKPFFYALI----A-GAGFFTVIASDLFRDLNDS 1119
gi 18202961 1090 -----lYKEFEPSLVNSTVYIMAMAMQMATFAINYKGPPFMESLPENKPLVWSLA----V-SLLAIIGLLLGSSPDFNSQ 1159
gi 731415   1092 -----lEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPFRENIRSNKGMYYGLL----G-VTGLALASATEFLPELNEA 1161
gi 19700788 1058 dnetelDEHNIQNYENTTVFFISSFQYLIVAIAFSKGKPFRQPCYKNYFFVFSVI----F-LYIFILFIMLYPVASVDQV 1132
gi 14285364 1036 ----vaAPDNLPNYENTVVFSLSSFQYLILAAAVSKGAPFRRPLYTNVPFLVALA----L-LSSVLVGLVLVPGLLQGPL 1106
gi 30581066 1039 ----ddEVEDKRSMQGTALFCVSMFQYIILALVYSKGPPFRGNLWSNKPMCALTI----F-ATLLCLFIVIWPTELVLKT 1109
gi 6707665   996 -----lEKSNTKNVLVTSIFLLSSLQYLGICIGINQSSEFLSPIWKKKTYVCLCT----TiGLCNIYLCFANENHIISRC 1066
gi 6707671   987 ----aeNNFQFETQHNTVLNFNILINFFYVIISNHIGKPMKDRYYKNTIAIYYDLgliyTcKCMILQVLLILEHTHHGLI 1062
                       1370
                 ....*....|....*..
gi 2493012  1415 LQLTPISNSFTMFIIVW 1431
gi 12229714 1120 LKLVPLPQGLRDKLLIW 1136
gi 18202961 1160 FGLVDIPVEF--KLVIA 1174
gi 731415   1162 MKFVPMTDDFKIKLTLT 1178
gi 19700788 1133 LQIVCVPYQWRVTMLII 1149
gi 14285364 1107 ALRNITDTGFKLLLLGL 1123
gi 30581066 1110 LGNVELPSLTFRIFIVI 1126
gi 6707665  1067 LQITRLPTLYRFIILFM 1083
gi 6707671  1063 FLILLLDQEFSSSLTVQ 1079
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap