Conserved Protein Domain Family
b_cpa1

?
TIGR00840: b_cpa1 
sodium/hydrogen exchanger 3
The Monovalent Cation:Proton Antiporter-1 (CPA1) Family (TC 2.A.36)The CPA1 family is a large family of proteins derived from Gram-positive and Gram-negative bacteria, blue green bacteria, yeast, plants and animals.Transporters from eukaryotes have been functionally characterized, and all of these catalyze Na+:H+ exchange. Their primary physiological functions may be in(1) cytoplasmic pH regulation, extruding the H+ generated during metabolism, and (2) salt tolerance (in plants), due to Na+ uptake into vacuoles.This model is specific for the eukaryotic members members of this family. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 273294
View PSSM: TIGR00840
Aligned: 5 rows
Threshold Bit Score: 665.712
Threshold Setting Gi: 6919935
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 127813   45 KWHHVQDPYIIALWILVASLAKIVFHLSHKVTSVVPESALLIVLGLVLGGIVWAADh---IASFTLTPTLFFFYLLPPIV 121
gi 127809   95 DYTHVRTPFEISLWILLACLMKIGFHVIPTISSIVPESCLLIVVGLLVGGLIKGVG----ETPPFLQSDVFFLFLLPPII 170
gi 127814   63 DYDYVQIPYEVTLWILLASLAKIGFHLYHRLPHLMPESCLLIIVGALVGSIIFGTHh---KSPPVMDSSIYFLYLLPPIV 139
gi 860721   29 DFEHTHKPLAFVFLIILVTLAKPTLHWP--VLRKLPESVVLMLYGVLMATAVKALMr---IDPGQLDTFMFFMILLPAIV 103
gi 6919935  55 TEEMFSSWALFIMLLLLISALWSSYYLTQKRIRAVHETVLSIFYGMVIGLIIRMSPghyiQDTVTFNSSYFFNVLLPPII 134
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 127813  122 LDAGYFMPNRLFFGNLGTILLYAVIGTIWNAATTGLSLYGVFLSGLMGELKIGLLDFLLFGSLIAAVDPVAVLAVFEEVH 201
gi 127809  171 LDAGYFLPLRQFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINNIGLLDNLLFGSIISAVDPVAVLAVFEEIH 250
gi 127814  140 LESGYFMPTRPFFENIGSILWWAGLGALINAFGIGLSLYFICQIKAFGLGDINLLQNLLFGSLISAVDPVAVLAVFEEAR 219
gi 860721  104 NDAGLSMQKKEFTIALPKILLFAVVGTVVHALLLAATMYGIEPIFSFKP---GFLHLFVFATLISAVDPVSVLSTFAELD 180
gi 6919935 135 LNSGYELNQVNFFNNMLSILIFAIPGTFISAVVIGIILY-IWTFLGLESIDISFADAMSVGATLSATDPVTILSIFNAYK 213
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 127813  202 VNEVLFIIVFGESLLNDAVTVVLYNVFESFVTl---gGDAVTGVDCVKGIVSFFVVSLG-GTLVGVIFAFLLSLVTRFTK 277
gi 127809  251 INELLHILVFGESLLNDAVTVVLYHLFEEFAN-----YEHVGIVDIFLGFLSFFVVALG-GVLVGVVYGVIAAFTSRFTS 324
gi 127814  220 VNEQLYMMIFGEALLNDGISVVLYNILIAFTKmh--kFEDIEAVDILAGCARFVIVGCG-GVFFGIIFGFISAFITRFTQ 296
gi 860721  181 VKKSLFILIFGESLCNDAVTIVLYRTSINVIKtsdasDEMLTITSVVGSCVVQFMIVCGfGLLCGAVVGFAGVFIMKNMV 260
gi 6919935 214 VDPKLYTIIFGESLLNDAISIVMFETCQKFHG------QPATFSSVFEG-AGLFLMTFSvSLLIGVLIGILVALLLKHTH 286
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 127813  278 HVR--IIEPGFVFVISYLSYLTSEMLSLSAILAITFCGICCQKYVKANISEQSATTVRYTMKMLASGAETIIFMFLGISA 355
gi 127809  325 HIR--VIEPLFVFLYSYMAYLSAELFHLSGIMALIASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVST 402
gi 127814  297 NIS--AIEPLIVFMFSYLSYLAAETLYLSGILAITACAVTMKKYVEENVSQTSYTTIKYFMKMLSSVSETLIFIFMGVST 374
gi 860721  261 GHQ--MNQPIFQLFCPYLAYLLAETGHYSGILASILCAAIMSYYMAANMCVEMEFAAFTFSKTGSSLSESCIFFYLGVSL 338
gi 6919935 287 IRRypQIESCLILLIAYESYFFSNGCHMSGIVSLLFCGITLKHYAYYNMSRRSQITIKYIFQLLARLSENFIFIYLGLEL 366
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 127813  356 VDP-VIWTWntAFVLLTLVFIS---------------VYRAIGVVLQTWILNRYR--MVQLETIDQVVMSYGGLRGAVAY 417
gi 127809  403 VAGsHHWNW--TFVISTLLFCL---------------IARVLGVLGLTWFINKFR--IVKLTPKDQFIIAYGGLRGAIAF 463
gi 127814  375 VGKnHEWNW--AFVCFTLAFCQ---------------IWRAISVFTLFYVSNQFR--TFPFSIKDQLIIFYSGVRGAGSF 435
gi 860721  339 VSYnHEFDF--YFIAVTVFCCT---------------LYRFLVTCTLSAFYNLFAseKNRIPFTDQLVVTHAGIRGAVCF 401
gi 6919935 367 FTEvELVYKplLIIVAAISICVarwcavfplsqfvnwIYRVKTIRSMSGITGENIsvPDEIPYNYQMMTFWAGLRGAVGV 446
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 127813  418 ALVVLLDEKKVKEKNLFVSTTLIVVFFTVIFQGLTIKPLVQWLKVKRSEQREPKLNEKLHGRAFDHILSAIEDISGQIGH 497
gi 127809  464 SLGYLLDKKHFPMCDLFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGH 543
gi 127814  436 SLAFLLPLTLFPRKKLFVTATLVVTYFTVFFQGITIGPLVRYLDVRKTNK-KESINEELHIRLMDHLKAGIEDVCGQWSH 514
gi 860721  402 GLVQIIDERIIPAKPYFVTTTLAMIFVTSILQGCTIKFVMKCLKIPGDDG--TKQKDPKALRWLTHLN------------ 467
gi 6919935 447 ALALGIQG---EYKFTLLATVLVVVVLTVIIFGGTTAGMLEVLNIKTGCIS----EEDTSDDEFDIEAP----------- 508
                      490       500       510       520       530       540       550       560
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 127813  498 NYLRDKWSNFDRKFLSKVLMRRSAQKSRdRILNVFHELNLKDAISYVAEGerrgSLAFIRSPstdnmvnvdfstPRPSTV 577
gi 127809  544 HHWKDKLNRFNKKYVKKCLIAGERSKEP-QLIAFYHKMEMKQAIELVESGgmgkIPSAVSTVsmq------nihPKSLPS 616
gi 127814  515 YQVRDKFKKFDHRYLRKILIRRNQPKS--SIVSLYKKLEMKQAIEMAETG----LLSSVAS-------------PTPYQS 575
gi 860721  468 DKYIKKFLVSENTYLPTDETFRNLGLP--KAVSTALRIGERSHTDLQRHG------EVSHT-------------PAPSVG 526
gi 6919935 509 -RAINLLNGSSIQTDLGPYSDNNSPDISiDQFAVSSNKNLPNNISTTGGN------TFGGLN-------------ETENT 568
                      570       580       590       600       610       620
               ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 127813  578 EASvsyflrenvsavcLDMQSLEQRRrSIRDtedmvthhTLQQYLYKPRQEYKHlYSRHELTPNEDE 644
gi 127809  617 ERI-------------LPALSKDKEE-EIRK--------ILRNNLQKTRQRLRS-YNRHTLVADPYE 660
gi 127814  576 ERIq-----------gIKRLSPEDVE-SMRD--------ILTRNMYQVRQRTLS-YNKYNLKPQTSE 621
gi 860721  527 RPT-------------IAPFDFGNMEeENNR--------LPSTGRRTPVARSQTrYSRHFIYAIPNE 572
gi 6919935 569 SPN--------------PARSSMDKR-NLRD--------KLGTIFNSDSQWFQN-FDEQVLKPVFLD 611
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap