4F99


Conserved Protein Domain Family
STKc_Cdc7

?
cd14019: STKc_Cdc7 
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 7 kinase
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. Cdc7 kinase (or Hsk1 in fission yeast) is a critical regulator in the initiation of DNA replication. It forms a complex with a Dbf4-related regulatory subunit, a cyclin-like molecule that activates the kinase in late G1 phase, and is also referred to as Dbf4-dependent kinase (DDK). Its main targets are mini-chromosome maintenance (MCM) proteins. Cdc7 kinase may also have additional roles in meiosis, checkpoint responses, the maintenance and repair of chromosome structures, and cancer progression. The Cdc7 kinase subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 270921
Aligned: 19 rows
Threshold Bit Score: 260.232
Threshold Setting Gi: 78709014
Created: 18-Aug-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 18 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              ####  # #                                            # #                
4F99_A      21 NVFKIEDKIGEGTFSSVYLATAQlqv-----------------------------gpeEKIALKHLIPTsHPIRIAAELQ 71   human
AAH85380    44 RIFRIIDKIGEGTFSSVYLAEAQmtd-----------------------------ssrRLFALKHLIPTsHPVRIAAELQ 94   zebrafish
NP_586127   19 PKYTPIEKIGEGSFSVVYKALDAes--------------------------------gRYVALKAITRTsSPARVLDEMM 66   Encephalitozoon ...
BAA19963    25 NIFYIKSKIGEGTFSSVYFAIGRlrs-----------------------------gedAKFALKHLIPTsHPTRIAAELQ 75   African clawed frog
NP_609876  143 KIFDVHCRIGSGTFSTVLLGTLQrergl-------------------------vetqrRRFAIKHHNPTnHPERILRELE 197  fruit fly
XP_629869  620 GKYRILEKIGQGTFSGVYKSVCIdgp-----------------------------nigLIVALKRVAPTsSPARILNEIH 670  Dictyostelium di...
EAT44136    57 NIFNIHRKIGHGTFSSVFLGTLKcherl-------------------------paekrKLFAIKHLVPTsHPSRIERELR 111  yellow fever mos...
XP_785538   76 ELFTVLDKIGEGTFSSVYRATLKktp-----------------------------dcnQEFALKHIIPTsHPSRILSELS 126  Strongylocentrot...
EDV27547    44 NLFKIIRKVGEGTFSKVYLAELLev-------------------------------pnNFFALKHLVPTsSPKRVENELR 92   Trichoplax adhae...
EIE87639   136 EYYDIMEKIGRGTFSTVYKALDIrrdlydneewlskmlskpytgedkaqhlndmknlsEFVALKRVYSTsSPQRISNEIH 215  Rhizopus oryzae ...
Feature 1                 #               #### #                                         ## #  
4F99_A      72 CLTVAggQDNVMGVKYCFRknDHVVIAMPYLEHeSFLDILnsLSFQEVREYMLNLFKALKRIHQFGIVHRDVKPSNFLYN 151  human
AAH85380    95 CLTVAggTENVMGVTYCFRkeHHVVIVMPYMEHqTFVDIVglLSFEDVRHYIYHLLKALKHIHKFGIIHRDIKPTNFLFN 174  zebrafish
NP_586127   67 FLKTLggRKNCMGLLGCFRneDQVVAVFPYFEPiDFREFIsnANLADIKRYLHNLLIAIEHVHSNGIMHRDLKPGNFLYN 146  Encephalitozoon ...
BAA19963    76 CLSVAggEDNVMGVKYCFRnkDHVVIVMPYLEHeCFADILhsLSFEETKEYMFNLLKALRHIHSFGIVHRDVKPSNFLFN 155  African clawed frog
NP_609876  198 CMYRIggVENVIGINCCIRynDNVAFIMPYMTHdRFHDIYrsLNFPEIRDYLRNLLIALRHVHKFNVIHRDVKPSNILYN 277  fruit fly
XP_629869  671 SLLRVggHYNVSALFGALRykDQVTLILPFFEHdSFKDYFfqMSNENIKHYLYALFDSLRHIHQNNICHRDVKPTNFLYS 750  Dictyostelium di...
EAT44136   112 CMMLIggASNVVGVDLCLRrqESVAFVMPFIAHdQFHVYYdkMTPTETQLYMKNLLIALKRVHEFNVIHRDVKPSNFLYN 191  yellow fever mos...
XP_785538  127 CLVRIggCHNVMGVKLTVRekDNIVIVMPHFKHnKFQDFYhdMTVKEVQDYLRALFIALRRVHKFNVIHRDVKPGNFLYN 206  Strongylocentrot...
EDV27547    93 CLHELrgQNNIIDVKACIRheDNIALVMPYIPHeKFQDYVykMSATDTRNYMRNLFIALKHVHSHSIIHRDIKPSNFLLS 172  Trichoplax adhae...
EIE87639   216 ILQELkgTSCISPLITAFRdgDDTFVVMPYIQNdDFNDLYntMSLLDIKSYLKSLFTALSQLHQLKIIHKDVKPNNFLYN 295  Rhizopus oryzae ...
Feature 1               #                                                                      
4F99_A     152 RrlKKYALVDFGLAQGTHDtkiellkfvqseaq----------------------------------------------- 184  human
AAH85380   175 RqkREYALVDFGLAQGTPDtqiellkgllskpkkeeviprkivsakhrsvpvrapln----------------------- 231  zebrafish
NP_586127  147 KesGRGMLIDFGLAQYEEYsegqhaeggakpagpllf------------------------------------------- 183  Encephalitozoon ...
BAA19963   156 RslKKFALVDFGLAQGTSDtkidllkvlqpkkqdglvgsstqrsvfgernfnvhsavtidnttlkaakpsk--------- 226  African clawed frog
NP_609876  278 RrtGKFLLCDFGLAQRIADdgsvvqssdlssrevfsilrdlengrsvtltdgnsaqaeaedymarrrmralggggsve-- 355  fruit fly
XP_629869  751 IknNSFLLIDFGLAQEMPNsnsnsnsnsnsnsnsnsnsnsnsnsnnnnnnnnnntnnnfngnnsnndfnnfinmnnsnsn 830  Dictyostelium di...
EAT44136   192 RkkQTFLLVDFGLAQDISSrvikeaateaedktgkrrlsgsvadgnhpssdaamqvqkkaklhddnmensttlasgeeqe 271  yellow fever mos...
XP_785538  207 RhsRKYALVDFGLAQAVPTrssakttvkpstvggvlhhdtprppqarkntrravstsenkaltrvepkrtqseshskvpk 286  Strongylocentrot...
EDV27547   173 SdtGKYFLLDFGLAQNAPQmptdvvhnenkcpqkat-------------------------------------------- 208  Trichoplax adhae...
EIE87639   296 ArkRVGYLIDFGLAQREEEtkhyeekpvaiddv----------------------------------------------- 328  Rhizopus oryzae ...
Feature 1                                                                                      
4F99_A         --------------------------------------------------------------------------------      human
AAH85380   232 -----------------------------------------------------------------------------qkq 234  zebrafish
NP_586127      --------------------------------------------------------------------------------      Encephalitozoon ...
BAA19963   227 --------------------------------------------------------------tidvttrklatrktvstk 244  African clawed frog
NP_609876  356 --------------------------------------------------------ravtgppsiqklreqagghltkkd 379  fruit fly
XP_629869  831 nnnnnnsn--------------------------------------nnnnnnnnnnnnnnnnsnnnnnsnnsqeeiilps 872  Dictyostelium di...
EAT44136   272 qlpppvfktplkqsnqiispmklsnitkdlyspplvrqikstvlgissnlkaaqrlqqgkssnttavspippktvtggtr 351  yellow fever mos...
XP_785538  287 lveldpntfhstdkssrdrsnhrld----svneddlkkkvpamiargsentaeviiapskekkptkppkpviltrncaai 362  Strongylocentrot...
EDV27547       --------------------------------------------------------------------------------      Trichoplax adhae...
EIE87639       --------------------------------------------------------------------------------      Rhizopus oryzae ...
Feature 1                                                                                      
4F99_A     185 --------------------qercsqnkcsiclsRRQQVAPRAGTPGFRAPEVLTKCpnQTTAIDMWSAGVIFLSLLSg- 243  human
AAH85380   235 klpaesqkpkpaavnplltcncymtdrvcniclsRKQQVAPRAGTPGFRAPEVLTKCpnQGTAIDMWSAGVILLSLLSg- 313  zebrafish
NP_586127  184 ----------------fnsvvsktkppgyyerdgRPPMKAPRAGTRGFRAPEVLFRCqrQTGAIDMWSVGVIFLTILTtq 247  Encephalitozoon ...
BAA19963   245 stssavpkkaastcqtsltcdcyakdqvcniclaRTRQVAPRAGTPGFRAPEALTKCphQTTAIDMWSAGIIFLSLLSg- 323  African clawed frog
NP_609876  380 vanqradtmrllnrlrlvspnadpnnyvvstntsKKEMHASRAGTPGYRPPEVLLRYpkQSTAVDVWAAGVIMLSLLSgl 459  fruit fly
XP_629869  873 tnengtttsnasstsnttsssssssnksknlrndPKPQPAPRAGTRGFRAPEVLLKYnkQTTAIDIWSVGVILLCMISg- 951  Dictyostelium di...
EAT44136   352 thqyntsssaspaakqdavckcfgksqvcnicmvKKEIQASRAGTPGYRPPEVLLKYpdQTTAVDVWAAGVMLASILSrc 431  yellow fever mos...
XP_785538  363 atrgvtrrlqdmpktpqgicgcyglprvcdvcmaKKNQVAPRAGTPGFRSPEVLLKCpdQTTAVDMWAAGVIFLSILSg- 441  Strongylocentrot...
EDV27547   209 -----------------dctslhgadqicnlciaKREQKAPREGTPGFRPPEVLLRYphQTTAIDIWSAGVVLLSILSah 271  Trichoplax adhae...
EIE87639   329 --------------------pliepvkgfdtkdpRKQVRANRAGTRGYRAPEVLLRVvhQTTAVDIWSAGIIFLSLLTkv 388  Rhizopus oryzae ...
Feature 1                                                                                      
4F99_A     244 RYPFYKAsdDLTALAQIMTIRGSretiqaaktfgksilcskevpaqdlrklce--------------------------- 296  human
AAH85380   314 RYPFFKAsdDLIALTQIMTIRGSketieaaktfgksivcsrelprldlrilcetlrglrswddaslp------------- 380  zebrafish
NP_586127  248 YPFFYSSd-DIDSIVEIATIFGHaemrkaakfygrvwrsnidsi------------------------------------ 290  Encephalitozoon ...
BAA19963   324 RYHFFNAadDMNALAQIMTIRGSketiqaskcfgksvlcskelpskdlrtlceglrsaivlpngnqhdiqkqraalqmri 403  African clawed frog
NP_609876  460 HPFFKAPh-DCGALAEIINLFGDmpvrktaflldrlillaqkvntldlrrvcmrfrhadfflapei-------------- 524  fruit fly
XP_629869  952 RYPFFISpdDMTSLAEIVSIIGTkkivdiahllekkisishsipp----------------------------------- 996  Dictyostelium di...
EAT44136   432 YPFFQNSd-DFHSLAEIVSIFGDqrikktanilgrhvktaqrkqpldlrklclrlrfrfrrlrarq-------------- 496  yellow fever mos...
XP_785538  442 RYPFFRApdDFTALAQIMSIMGTeetteaakvngknllcnvklpamelktmcrqlrlgavqrrqskssqs---------- 511  Strongylocentrot...
EDV27547   272 YPFFKAEd-DMTALAQIMSITGS--------------------------------------------------------- 293  Trichoplax adhae...
EIE87639   389 FPFFVGYd-EADSIVEIANIFGIqelqkmalkynrvihtnipglpkq--------------------------------- 434  Rhizopus oryzae ...
Feature 1                                                                                      
4F99_A     297 ----------------rlrgmdsstpkltsdiqghatnlegwnevpDEAYDLLDKLLDL-------NPASRITaEEALLH 353  human
AAH85380   381 --aefqashnpaeekeeaespalkstgsrlcrssaelkeigwdrvpDEVYDLLDKLLDL-------NPATRITaSTALQH 451  zebrafish
NP_586127  291 -------------------------peeripfetiveslnpwaevgSDGYDLLYRMLDL-------CSSSRITaSDALSH 338  Encephalitozoon ...
BAA19963   404 menqdgwflpespditpdspavvrsscvstsdnmeqsnhngwdrvpNEAYHLLDRLLDM-------NPATRITaEEALIH 476  African clawed frog
NP_609876  525 ---qrkyqrpdgttemcrsceqptfnclcsnsghnlerydgldifpAVAYDLLSRLLEV-------NPQKRITaEEALKH 594  fruit fly
XP_629869  997 ------------------------tpwrdlsrrlrsesscdkqdvpVELYDLLERCLDP-------NPLTRITaSEALLH 1045 Dictyostelium di...
EAT44136   497 ---qqqpeeesaatfanscdncqqrldeclcehseanrdfsedeysDSAYDLLYKLLEI-------NPHNRISaEEALKH 566  yellow fever mos...
XP_785538  512 ngesskrrrrsinqtsppkeetvgspesqrsvgsvgseeglvdqfpDTAYDLLGRLLEL-------DPHKRITaEQALKH 584  Strongylocentrot...
EDV27547   294 ----------------------------------------------KEMAATAKSLGKRisnnpeiPPLDLKTvCTKLRR 327  Trichoplax adhae...
EIE87639   435 ----------------------kislkklcayyngdklkewpekdiRNAMNLLESCLQL-------DPVTRITaQDALNH 485  Rhizopus oryzae ...
Feature 1         
4F99_A     354 PFF 356  human
AAH85380   452 PLF 454  zebrafish
NP_586127  339 PFF 341  Encephalitozoon cuniculi GB-M1
BAA19963   477 PLF 479  African clawed frog
NP_609876  595 PFF 597  fruit fly
XP_629869 1046 PFL 1048 Dictyostelium discoideum AX4
EAT44136   567 PYF 569  yellow fever mosquito
XP_785538  585 PFL 587  Strongylocentrotus purpuratus
EDV27547   328 NRS 330  Trichoplax adhaerens
EIE87639   486 PFL 488  Rhizopus oryzae RA 99-880

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap