3BLH,3BLQ,4BCF


Conserved Protein Domain Family
STKc_CDK9

?
cd07865: STKc_CDK9 
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. CDK9, together with a cyclin partner (cyclin T1, T2a, T2b, or K), is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multiple steps of gene expression including transcription elongation, mRNA synthesis, processing, export, and translation. It also plays a role in mediating cytokine induced transcription networks such as IL6-induced STAT3 signaling. In addition, the CDK9/cyclin T2a complex promotes muscle differentiation and enhances the function of some myogenic regulatory factors. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 270848
View PSSM: cd07865
Aligned: 15 rows
Threshold Bit Score: 557.753
Threshold Setting Gi: 193624826
Created: 24-Sep-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 18 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                           ####    #             # #                              #     
3BLH_A         7 DSVECPFCDEvsKYEKLAKIGQGTFGEVFKARHRk-tGQKVALKKVLMENEKEGFPITALREIKILQLLkHENVVNLIEI 85  human
3BLQ_A         7 DSVECPFCDEvsKYEKLAKIGQGTFGEVFKARHRk-tGQKVALKKVLMENEKEGFPITALREIKILQLLkHENVVNLIEI 85  human
Q9TVL3        72 DQATYPFIRDvsTYEKLNKIGQGTFGEVFKARCKn-tGRMVALKKILMENEKEGFPITALREVKMLEQLkHPNITDLIEV 150 nematode
CAZ36626      31 ELEGISKTKPvdQYVRLQKIGQGTFGEVFKVRHKs-tKQHFALKRIRMEQEKEGFPITALREIRILQSLnHENIVCLKEI 109 Schistosoma man...
XP_002131004   7 PNMDFPFCQDvlKYERITKIGQGTFGEVFKARDRk-tDRLVALKKVIMENEKEGFPITALREIKILQLLkHENVVDLIEI 85  Ciona intestinalis
XP_798269     35 ESPEFKYCEEvsKYDKLAKIGQGTFGEVFKAKHKk-nKNIVALKKVLMENEKEGFPITALREIRILQLLrHENVVPLYEI 113 purple urchin
AAM50669      37 EDYDFPYCDEsnKYEKVAKIGQGTFGEVFKAREKkgnKKFVAMKKVLMDNEKEGFPITALREIRILQLLkHENVVNLIEI 116 fruit fly
NP_997756     27 DGVEFPFCDEfsKYEKLAKIGQGTFGEVFKAKHRq-tGKKVALKKVLMENEKEGFPITALREIKILQLLkHENVVNLIEI 105 zebrafish
Q5ZKN1         6 DMVECPFCDEvsKYEKLAKIGQGTFGEVFKAKHRq-tGKKVALKKVLMENEKEGFPITALREIKILQLLkHENVVNLIEI 84  chicken
XP_001626865   4 DTLDFPYCHEvsKYERQAKIGQGTFGEVFKAKNRknpKEIVALKKVLMDNEKEGFPITALREIKILQLLnHENVVKLLEI 83  starlet sea ane...
Feature 1                            ####  #  #                                        ## #      
3BLH_A        86 CRTKasp--ynrCKGSIYLVFDFCEHDLAGLLSnvlvkFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITrdGV 163 human
3BLQ_A        86 CRTKasp--ynrCKGSIYLVFDFCEHDLAGLLSnvlvkFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITrdGV 163 human
Q9TVL3       151 CSAKstgttgskDRATFYLVMALCAHDLAGLLSnpkirMSLVHIKTMMKHLMSGLNKLHRSKILHRDMKAANVLISkdGI 230 nematode
CAZ36626     110 CHSPpna--gngFKPQFYLVFEFCDHDLAGLSQqi--dFTEPVKKAIMKQLLTGVFYLHLNNVLHRDLKAANILIDknGI 185 Schistosoma man...
XP_002131004  86 CRTKptq--ynrSKGSIYLVFEFCAHDLAGLLSnatvkFTLGEIKKTMLQLLEGLFYIHRNKILHRDMKAANILITknGV 163 Ciona intestinalis
XP_798269    114 CRTKata--ynrYKGSIYLVFEFCEHDLAGLLSntnvkFSLGEIKSVIKQLLNGLYYIHSNKVLHRDMKAANILITkaGV 191 purple urchin
AAM50669     117 CRTKata--tngYRSTFYLVFDFCEHDLAGLLSnmnvkFSLGEIKKVMQQLLNGLYYIHSNKILHRDMKAANVLITkhGI 194 fruit fly
NP_997756    106 CRTKatq--fnrYKGSIYLVFDFCEHDLAGLLSnanvkFTLAEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITrdGV 183 zebrafish
Q5ZKN1        85 CRTKasp--ynrCKGSIYLVFDFCEHDLAGLLSnthvkFTLSEIKKVMQMLLNGLYYIHRNKILHRDMKAANVLITrdGV 162 chicken
XP_001626865  84 CRTKaqp--fnrNKASIYLVFEFCEHDLAGLLNnqavkFSPPEMKKIMQMLLNALYFIHSNKILHRDMKAANILITknGV 161 starlet sea ane...
Feature 1            #                                                                           
3BLH_A       164 LKLADFGLARAFSLAKNSq--pNRYXNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL 241 human
3BLQ_A       164 LKLADFGLARAFSLAKNSq--pNRYXNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL 241 human
Q9TVL3       231 LKLADFGLARPFVQRENGagprPLYTNRVVTLWYRPPELLLGDRQYGTKIDVWGAGCIMAEMWTRQPIMQGDTEQKQLQL 310 nematode
CAZ36626     186 LKIADFGLARTTVASIRPdr-pTRYTGRVVTLWYRPPEILLNDRHYGKPVDMWGAGCIMAELWTKYPIMQGDNEISQLNL 264 Schistosoma man...
XP_002131004 164 LKLADFGLARAFSYTKTGq--aNRYTNRVVTLWYRPPELLLGDRDYGPPIDLWGAGCIMTEMWTRSPIMQGHTEQQQLTL 241 Ciona intestinalis
XP_798269    192 LKLADFGLARAFSLPKGDa--pNRYTNRVVTLWYRPPELLLGERNYGPAIDLWGAGCIMAEMWTRSPIMQGNTEQHQLTL 269 purple urchin
AAM50669     195 LKLADFGLARAFSIPKNEs--kNRYTNRVVTLWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTF 272 fruit fly
NP_997756    184 LKLADFGLARAFSLAKNSq--gNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLTL 261 zebrafish
Q5ZKN1       163 LKLADFGLARAFSLAKNSq--pNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGGGCIMAEMWTRSPIMQGNTEQHQLTL 240 chicken
XP_001626865 162 LKLAEFGLARAIHINKEQk---QRYTNRVVTLWYRPPELLLGERNYGPPIDLWGAGCIMAELWTRTPIMQGNTEQHQLTL 238 starlet sea ane...
Feature 1                                                                                        
3BLH_A       242 ISQLCGSITPEVWPNv-dNYELYEk------LELVKGQKRKVK--DRLKAyv--------------------rDPYALDL 292 human
3BLQ_A       242 ISQLCGSITPEVWPNv-dNYELYEk------LELVKGQKRKVK--DRLKAyv--------------------rDPYALDL 292 human
Q9TVL3       311 ISGLCGSINKDVWPNc-vNMPLWSamssepnSALPQGKYRILPnkMKNLMkfdapdsktdpfgknvkqhdsatDDDALHL 389 nematode
CAZ36626     265 IINLCGSITPEIWPGv-eRLETFRe------ARLPQDIKRHVR--EKLTPki--------------------sSLAAVDL 315 Schistosoma man...
XP_002131004 242 ISQLCGSITKQVWPGv-eKYDLFTk------MELPTGQKRRVK--ERLKAyv--------------------rDQYALDL 292 Ciona intestinalis
XP_798269    270 ISHLCGSITSAVWPGl-eKLELSNt------LELPKGHKRKVK--DRLRSyv--------------------kDQQALDL 320 purple urchin
AAM50669     273 ISQLCGSFTPDVWPGv-eELELYKs------IELPKNQKRRVK--ERLRPyv--------------------kDQTGCDL 323 fruit fly
NP_997756    262 ISQLCGSITPEVWPGvdkKYELYQk------MELPKGQKRKVK--DRLKAyv--------------------kDPYALDL 313 zebrafish
Q5ZKN1       241 ISQLCGSITPEVWPNv-dKYELYQk------LELPKGQKRKVK--DRLKAyv--------------------kDPYALDL 291 chicken
XP_001626865 239 ISHLCGSITPEVWPGv-dKLELFDk------MVLPSGQKRRVK--ERLRMyv--------------------kDHNALDL 289 starlet sea ane...
Feature 1                                
3BLH_A       293 IDKLLVLDPAQRIDSDDALNHDFF 316 human
3BLQ_A       293 IDKLLVLDPAQRIDSDDALNHDFF 316 human
Q9TVL3       390 LEILLAIDPDKRPTSDEAEDDIWF 413 nematode
CAZ36626     316 IDQLLVLDPSKRLDAEQALSHDYF 339 Schistosoma mansoni
XP_002131004 293 IDKLLSLDPKHRIDSDEALNHDFF 316 Ciona intestinalis
XP_798269    321 IDKLLNIDPKRRMDAAIALDHDFF 344 purple urchin
AAM50669     324 LDKLLTLDPKKRIDADTALNHDFF 347 fruit fly
NP_997756    314 IDKLLVLDPAQRIDSDDALNHDFF 337 zebrafish
Q5ZKN1       292 IDKLLVLDPAQRIDSDDALNHDFF 315 chicken
XP_001626865 290 IDKMLSLDPGPRIDADSALNHDYF 313 starlet sea anemone

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap