Conserved Protein Domain Family
bZIP_ATF4

?
cd14692: bZIP_ATF4 
Click on image for an interactive view with Cn3D
Basic leucine zipper (bZIP) domain of Activating Transcription Factor-4 (ATF-4) and similar proteins: a DNA-binding and dimerization domain
ATF-4 was also isolated and characterized as the cAMP-response element binding protein 2 (CREB2). It is a Basic leucine zipper (bZIP) transcription factor that has been reported to act as both an activator or repressor. It is a critical component in both the unfolded protein response (UPR) and amino acid response (AAR) pathways. Under certain stress conditions, ATF-4 transcription is increased; accumulation of ATF-4 induces the expression of genes involved in amino acid metabolism and transport, mitochondrial function, redox chemistry, and others that ensure protein synthesis and recovery from stress. bZIP factors act in networks of homo and heterodimers in the regulation of a diverse set of cellular processes. The bZIP structural motif contains a basic region and a leucine zipper, composed of alpha helices with leucine residues 7 amino acids apart, which stabilize dimerization with a parallel leucine zipper domain. Dimerization of leucine zippers creates a pair of the adjacent basic regions that bind DNA and undergo conformational change. Dimerization occurs in a specific and predictable manner resulting in hundreds of dimers having unique effects on transcription.
Statistics
?
PSSM-Id: 269840
View PSSM: cd14692
Aligned: 36 rows
Threshold Bit Score: 55.6602
Threshold Setting Gi: 555694851
Created: 13-Jun-2013
Updated: 2-Mar-2014
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 14 residues -Click on image for an interactive view with Cn3D
Feature 1:DNA binding site [nucleic acid binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
Feature 1             ## ### ###### ###                                         
1CI6_A         1 MKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEV 63
gi 393909298 247 GISERKREQNRCAAIRYRGKRREEAKQKKEELHKLELRNIELKAEMNCLEKEVIYLRSLMELA 309
gi 17566652  421 EETDRRRMLNRIAAVRYREKKRAEKKGRKMEFQEVADRNRILLQKERQLKREINSMKKELRKM 483
gi 17542828  162 KLLSRKRQQNKVAAARYRDKQKAKWQDLLDQLEAEEDRNQRLKLQAGHLEKEVAEMRQAFLAK 224
gi 212646363 109 EIAERKKQQNRAAALRYRQKLRESRVMSVSVKETLTQRNAYLRDEAERLSKECEVIRRLIFDK 171
gi 555694025 341 YMSKRKREQNKRAATKYRNKKKMEELENVERLEKLLDRNRELKDIVKSREHEVNVMKRLLMDV 403
gi 541044372 265 FISEKKREQNRSAAIRYRDRRREEAKRKREELHELELRNVALKTQVSGLSKEIGYLRGILNEM 327
gi 560140626 272 EINARKREQNRAAAQRYREKRRNYKESEKEEEERLEKRNSFLRTEAKRLQEEIDELRKTILGG 334
gi 556100112  82 MKKERRREQNRKAATKCRRKKKNAKIEKESEMKTLKNENEKLSEMVRELQGQVKQYAAILRHH 144
gi 17569589  139 EKKERKKAQNRLAATRYREKKRREKEEAMTCIEGLSVTNGKLKDQVSELEREIRYFKKFMTEM 201

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap