Conserved Protein Domain Family
DUF4605

?
pfam15378: DUF4605 (this model, PSSM-Id:259510 is obsolete and has been replaced by 317745)
Domain of unknown function (DUF4605)
This protein family is a domain of unknown function, which is found in eukaryotes. Proteins in this family are typically between 82 and 137 amino acids in length.
Statistics
?
PSSM-Id: 259510
View PSSM: pfam15378
Aligned: 11 rows
Threshold Bit Score: 58.4161
Threshold Setting Gi: 291404234
Created: 31-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 196004774 108 GVVGQINQQLTSFGIPQFTIANRVVEPIALVGGLILLMVFGVRGLLLGGVLWFVTQPN 165
gi 157820751  70 TLFGELNKNLLNMGFTRMYFGERIVEPVVVIFFWLMLWFLGLQALGLVAVLCLVIIYV 127
gi 348541457  87 TLFGSLNKCLRGMGFSQMYFGDKIVEPVVIVFFWLLLWFLGIQALGLVGTLCIIIIYI 144
gi 345795861  76 TLFGELNKSLIDMGFTRMYFGERIVEPVIVIFFWIMLWFLGLQALGLVAVLCLVIIYV 133
gi 327277970  63 SPFSDINQQLVNMGFPTWNLGNQVVEPVMSILLLFLLMMVGVRGLLLVGLIYVVSHLS 120
gi 198418857  64 TVFDTWNEKLLQLGIPRWNIGSHVVEPIMTTAMVVVLLMFGLPGVLFLGLLYFVVTIS 121
gi 156362615  56 SMFDQFNNKLIELGFPRWNIGDNVVEPIVSVALLLALVFFGIKGVLMVAVVCYLLRQA 113
gi 432941029  65 TLFGMINKCLRGIGFSHMYFGNHTVEPVVILFFWLLLWFLGIQALGLVGTLCIIIIYI 122
gi 308461619 158 NIIDTINQRLNGFGIPNIDAGGFQIQPFHMCLALTLLFFFGPFGALIALAICFFTQQr 215
gi 260802704  52 SMFDAINQKLLALGIPRFQLMGTTVEPIATVGVTVVFLLMGVRGLLFIGLLFGVSYLS 109
gi 291404234  66 SPFNDLNRQLVHMGFPQWHLGNHTVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLS 123
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap