Conserved Protein Domain Family
CCDC144C

?
pfam14915: CCDC144C (this model, PSSM-Id:259052 is obsolete and has been replaced by 317340)
CCDC144C protein coiled-coil region
This family includes the human protein CCDC144C and the ankyrin repeat domain-containing protein 26-like 1 found in eukaryotes. Its function remains unknown, however, it is known to contain a coiled-coil domain which corresponds to this region. The ankyrin repeat which features in this protein is a common amino acid motif.
Statistics
?
PSSM-Id: 259052
View PSSM: pfam14915
Aligned: 15 rows
Threshold Bit Score: 298.534
Threshold Setting Gi: 82266449
Created: 30-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:
pfam14915 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182627628  514 NCILKADIAILRQEICTMKNDNLEKENKYLKDIKIVKETNAALEKYIKLNEEMITETAFRYQQELNDLKAENTRLNAELL 593
gi 166898074  327 NFMLKKDIAMLKEELYAIKNDSLRKEKKYIQEIKSITEINANFEKSVRLNEKMITKTVARYSQQLNDLKAENARLNSELE 406
gi 302393830  561 NHLMRDEIARLRLEIDTIKHQNQETENKYFKDIEIIKENNEDLEKTLKRNEEALTKTITRYSKELNVLMDENTMLNSELQ 640
gi 380865477 1084 NCMLKKEIAMLKLEVATLKHQHQVKENKYFEDIKILQEKNAELQMTLKLKQKTVTKRASQYREQLKVLTAENTMLTSKL- 1162
gi 162416239  634 NCMLQEEIALLRLEIDTIKNQNKQKEKKYFEDIEVVKEKNDNLQKIIKRNEETLTETILQYSGQLNNLTAENKMLNSELE 713
gi 82266449   102 IATLQEQLTTSKRDLEHSCANSSLRECTLSEENRVLKDQLEDARRDLKLNSESLKNTVFNSNNEVSSLKSELSETRTRLE 181
gi 359079962  720 KHMLQEEIAMLRLEIDALKNQHREKEENYFEDIEILKVKNDDLQKAIKLNEETLTKTISHYTGQLNALTAENTMINSKLE 799
gi 124487433  886 NQRLQDEVAVLRLEMDTIKSHNQEKEKRYLEDIKIANEKNDNLQRMVKLNEETFTKTIFQYTGQLNSLKAENTMLSSKLD 965
gi 350594637  198 NLMIQDEIATLKREIDTIKNENQEKEKKYLEDIEIVKQKNDELQKAIKLNEEKLTQT---YSGQLHDLTAENTRLKSKLK 274
gi 350594635  630 NHMSQNEIAMLKQKIEVIKNHSQEMGKKCFRDIKIAKNKFAKLQERVKL-EDILTKTILKCSRRLNVLTAENTRLKSELD 708
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182627628  594 KEKESKKRLEADIESYQSRLAAAIGKHSEsVKTERNVKLALERTQD--VSVQVEMSSAISKVKDENEFLTEQLSETQIKF 671
gi 166898074  407 KEKHNKERLEAEVESLHSSLATAINEYNE-IVERKDLELVLWRADD--VSRHEKMGSNISQLTDKNELLTEQVHKARVKF 483
gi 302393830  641 KEKQSMSRLETEMESYRCRLAAALCDHDQrQSSKRDLQLAFQSTVNewCHLQEDTNSHI-------QILSQQLSKAESTS 713
gi 380865477 1163 KEKQDKEILETEIESHHPRLASALQDHDQsVTSRKNQELAFHSAGD--APLQGIMNVDVSNTIYNNEVLHQPLYEAQRKS 1240
gi 162416239  714 NGKENQERLEIEMESYRCRLAAAVHDCDQsQTA-RDLKLDFQRTRQewVRLHDKMKVDMSGLQAKNEILSEKLSNAESKI 792
gi 82266449   182 NERYTCERLETELESIRTRLSGAEKEAERsHVAKSERESTLLREKEehQHLKGKLTGEVAILREENSTLSQKLIKAEAQA 261
gi 359079962  800 NKKESKXKTGTEVKSYCSRLAAALHDHDXgQTSKRDLELAFQRARDewLCLQDKMKYDVANLKDNSEMLSQQLSTVESIF 879
gi 124487433  966 NEKQNKERLETDVESFRSRLASALHDHAEiQTAKRDLEIAFQRARDewFRVKDKMNFDMSNLRDNNEVLSQQLSKTERKL 1045
gi 350594637  275 KEEQKTESLETDVALYCSKLTTAMSDHEQsQTAKRDLELTFQRARGewLCLQDKMNLEMSNLKDHNKLLLQQLSETQRKF 354
gi 350594635  709 NERQNKERPERQVESSHSGLAAATHDQEQsQTSERDLELAFQRAEDkcFPFQDEINLDVSNLKD-SKMHSQQLSTTEGKS 787
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182627628  672 NALKDKFRKTRDSLRKKSLALETV--QNDLRKTQQQTQEMKEMYQNAEAKVNNSTG-KWNCVEERICHLQRENAWLVQQL 748
gi 166898074  484 NTLKGKLRETRDALREKTLALGSV--QLDLRQAQHRIKEMKQMHPNGEAKESQSIG-KQNSLEERIRQQELENLLLERQL 560
gi 302393830  714 SGLETELHYEREALKEKTLHIEHM--QGVLSRTQRRLEDIEHMYQNDQPILEKYVR-KQQSVEDGLFQLQSQNLLYQQQC 790
gi 380865477 1241 KSPKINLNYAGDDLRENALVSEHA--QRDRCETQCQMKKAEHMYQNEQDNVDKHTE-QQESLEQKLFQLESKNRWLRQQL 1317
gi 162416239  793 NSLQIQLHNTRDALGRESLILERV--QRDLSQTQCQKKETEQMYQS---KLKKYIA-KQESVEERLSQLQSENMLLRQQL 866
gi 82266449   262 NNLENEAHRVTQQLKDKGLLQEVL--QREKEQAVTRGLELEKTLHAEREQFSRDRA-RHEATQERLTQAQSEVMLLRQQL 338
gi 359079962  880 NKLKIKLHHTRDDLREKTLMLERV--QRDLSQSECQKQEIEHXYQNEQGKVNTCLG-KQESLEERLSQLQSENMLLRQQL 956
gi 124487433 1046 NSLEIEFHHTKDELREKTLALKHA--QRDLSQTQCQMKEVEHMFQDEQGKVSKFMG-KQESIEERLAQLQSENTLLRQQL 1122
gi 350594637  355 SSLDIEMHHTRDALRENSLLLEQV--QRELSQAQCQKKESEDPCLCEHGKVKEYMG-KQERLEERLAQFESVNLLLQEQL 431
gi 350594635  788 NSLETELHHRRDALGEKSLVFEPVpvQRDLSQAQCQKKEIAHMPPSEQGKVKKYMGeQQESLKERSSQLESENLLLRQQL 867
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 182627628  749 DDVHQKEDHKE-IVTNIQRGF--------IESGKKDLvLEEKSKKLMNECDHLKESLFQYEREKAEGV 807
gi 166898074  561 EDARKEGDNKE-IVINIHRDC--------LENGKEDL-LEERNKELMKEYNYLKEKLLQCEKEKAERE 618
gi 302393830  791 NDARKKADNQEkTIINIQVKCedtveklqAECRK----LEENNKGLMKECTLLKERQCQYEKEKEERE 854
gi 380865477 1318 VYAHKKVN-KSkVTINIQ-----------FPEMKMQRhLNEKNEEVFNYGNHLKERIDQYEKEKAERE 1373
gi 162416239  867 DDVHKKANSQEkTISTIQDQFhsaaknlqAESEKQILsLQEKNKELMDEYNHLKERMDQCEKEKAGRK 934
gi 82266449   339 EEAQNKGLAKErAVTDAQGHLkdilsklqSDYEERVQlVKERNKELDSKANDLQDHIHKLQDEKNEIK 406
gi 359079962  957 GNAQNRANSKVkTVISIQDQFqqivrklqAKYEKQGLlLEKRNNELIKEYNHLKERMYWYENEKAEGK 1024
gi 124487433 1123 DDAANKAESKDkTIVNIQDQFqdvltrfqAESQRHSLrLEDRNQELVSECSHLRERLCQYENEKAERE 1190
gi 350594637  432 DDAKNKIESKEkMVMGSQERFqdilknlqDQREKESLmLEESLKKLTNEVDLLKERLSQAENVKTQRa 499
gi 350594635  868 DDLQKEVDSKEkMVNNLQDQCldsikklqAESEKPHLmLKERNKELPEECSHLKERRNQYENEKTERE 935
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap