2DM3,2VAJ,4C4K,1WIT


Conserved Protein Domain Family
I-set

?
pfam07679: I-set (this model, PSSM-Id:254352 is obsolete and has been replaced by 400151)
Click on image for an interactive view with Cn3D
Immunoglobulin I-set domain
Statistics
?
PSSM-Id: 254352
View PSSM: pfam07679
Aligned: 48 rows
Threshold Bit Score: 72.6753
Threshold Setting Gi: 66773952
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DM3_A     10 PHFLQAP-GDLTVQEGKLCRMDCKVSGL-PTPDLSWQLD--GKPVRP------------DSAHKMLVREng-----vhSL 68   human
O15146    121 PKITRPP-INVKIIEGLKAVLPCTTMGN-PKPSVSWIKG--DSPLRE------------NSRIAVLESG---------SL 175  human
Q96RW7   1171 PKIQRGP-KHLKVQVGQRVDIPCNAQGT-PLPVITWSKG--GSTMLV------------DGEHHVSNPDg--------TL 1226 human
Q62407    727 PVFEIPL-QNMVVAPGADVLLKCIITAN-PPPQVSWKKD--GSMLHS------------EGRLLIRAEGer------hTL 784  house mouse
2VAJ_A      1 LQVTISL-SKVELSVGESKFFTCTAIGE-PE-SIDWYNPq-GEKIIS------------TQRVVVQKEGvr------sRL 58   human
O00557     20 LQVDIVP-SQGEISVGESKFFLCQVAGDaKDKDISWFSPn-GEKLTPn-----------QQRISVVWNDds-----ssTL 81   human
Q28260     25 SKMEIFLePRVAAQIGDVISLTCSTTGC-ETPSFSWRTQi-DSPLN----------------GKVKNEGnn------sTL 80   dog
4C4K_O      5 PRFLTRP-KAFVVSVGKDATLSCQIVGN-PTPQVSWEKD--QQPVAA------------GARFRLAQDGdl------yRL 62   human
Q8NDA2   4303 PVFQVEP-QDMTVRSGDDVALRCQATGE-PTPTIEWLQA--GQPLRA------------SRRLRTLPDG---------SL 4357 human
AAL31708   12 PVISQIS-KDVVASVGDSVEFNCTVEEV-GQLSVSWAKRpsESDTNSvvlsmrnilslpDQRYNVTVTEgpktgsaiyTF 89   Drosophila simulans
2DM3_A     69 IIEPVTSRDAGIYTCIATNR-AGQNSFSLELVV 100  human
O15146    176 RIHNVQKEDAGQYRCVAKNSlGTAYSKVVKLEV 208  human
Q96RW7   1227 SIDQATPSDAGIYTCVATNI-AGTDETEITLHV 1258 human
Q62407    785 LLREAQAADAGSYTATATNE-LGQATCASSLAV 816  house mouse
2VAJ_A     59 TIYNANIEDAGIYRCQATDAkGQTQEATVVLEI 91   human
O00557     82 TIYNANIDDAGIYKCVVTGEdGSESEATVNVKI 114  human
Q28260     81 TMDPVSFNNEHAYLCTATCG-SKKLEKGIQVEI 112  dog
4C4K_O     63 TILDLALGDSGQYVCRARNA-IGEAFAAVGLQV 94   human
Q8NDA2   4358 WLENVETGDAGTYDCVAHNL-LGSATARAFLVV 4389 human
AAL31708   90 RIQNIEVSDMGPYECQVLVSaTEKVTKKLSLQI 122  Drosophila simulans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap