Conserved Protein Domain Family
Mt_ATP-synt_B

?
pfam05405: Mt_ATP-synt_B (this model, PSSM-Id:253182 is obsolete and has been replaced by 283144)
Click on image for an interactive view with Cn3D
Mitochondrial ATP synthase B chain precursor (ATP-synt_B)
The Fo sector of the ATP synthase is a membrane bound complex which mediates proton transport. It is composed of nine different polypeptide subunits (a, b, c, d, e, f, g F6, A6L).
Statistics
?
PSSM-Id: 253182
View PSSM: pfam05405
Aligned: 32 rows
Threshold Bit Score: 96.1904
Threshold Setting Gi: 75274677
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam05405 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2CLY_A       41 LILYLLSKEIYVITPETFSAISTIGFLVYIVKKYGASVGEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEK-SQQAL-V 118
gi 75173536  12 LIFVFISKEFIVFNEEVLVLLSFFIFIFLVINYGKDSINESLNSKLEEIKNEFDFYKNLQKQTISYLINYHK-KQVLL-V 89
gi 74763663  18 LVAILTARDFIIVHDETLVLLCFILFLTFLYVALKDMVTASFNDRALQIEKEFNDSYSLKEQTLQLLANHHE-KQVSL-L 95
gi 74811991  17 TVAIFVAQDLVIVDEEVLVLLCFVLFLFLLYQTTSHMISSELHSRAMKIRDEFEENHLLQEDVYLTVLHYHG-KQLSL-Q 94
gi 74811992  19 IIAGLAAEGILTVNAQFLVALCFAFFIIFAYLNVKDVVVSELNDRASQIQKEFEDAFRLKEEVLKTIVSYYR-KQLHL-T 96
gi 74811987  18 SVAGFVSKEILVLNAEALVALCFILFVIFIYVTAKDVIVAELKDRASQIQKEFDDSYLLKEELYETLMGYHK-KQVSL-L 95
gi 127082    20 SICASSPKKISIYNEEMIVARCFIGFLILSWKSLGKTFKETLDGRIESIQESLQQFFNPNEVILEESNEQQRlLNLWIsL 99
gi 127083    20 SICASSSKKISIYNEEMIVALCFIGFIIFSWKSLGKTFKVTLDGRIQAIQEESQQFPNPNEVVPPESNEQQR-LLRIS-L 97
gi 55977283  20 SICASSPKKISIYNEEMIVARCFIGFLIFSRKSLGKTFKETLDGRIESIQEELLQFFNPNEVIPEESNEQQR-LLRIS-L 97
gi 266533    21 SICASSPKKISIYNEEMIVARCFIGFLIFSRKSLGKTFKETLDGRIESIQEELQQFFNPKQVIPGESNEQQR-LLRIS-L 98
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2CLY_A      119 QKRHYLFDVQRNNIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQEHMINWVEKRVVQSISA-QQ----EKET 193
gi 75173536  90 NNVKKILEFSKLELKIVENYFNILGRNKTKLNFEDKLKKIVNCESQKNVFIQDFYLSNLNNFFITKYGT-LLkfeiFNKS 168
gi 74763663  96 NEIDSLMLFTKSEVNNIIQTRQAALRARLISEFRTKLNTAVKKEDAFFQFIQQTTNTIVMNSILENISG-PTgealKNTS 174
gi 74811991  95 NEIQDLFVWTKEQIKELIQTRSQALTNSLLKETEEKCKWIIMKEQNFLQSMQEETSSYLTSKVISNSAEl------DALT 168
gi 74811992  97 EEITSIYQFSKEQIHLIISSRRKALESKLMQEIGTKLETVLMKEKALYSSMQTEAVNYIVAQILNASQE-DLlr-lDKEC 174
gi 74811987  96 EEINEIFMFSKEQIEKIISTRKEALKYKISNEIENKLKTIAIKEQALLRYMQLETNRYITEQILTEAAD--TsselNQKA 173
gi 127082   100 RICSTVKVVESLPAARCAPKCEKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERLVS-GSttlvEAST 178
gi 127083    98 RICGTVVESLP--MARCAPKCEKTVQALLCRNLNVKSATLPNATSSRRIRLQDDIAIKMHVLVGKRFCPwCSskaeRVEF 175
gi 55977283  98 RICSTVVESLP--TARCAPKCEKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERFVS-GSt--fKAST 172
gi 266533    99 RICSAVVESLP--TAACAPKCEKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERFVS-GSt--fKAST 173
                       170
                ....*....|..
2CLY_A      194 I---AKCIADLK 202
gi 75173536 169 I---RRNI-ILR 176
gi 74763663 175 F---EEGIRILE 183
gi 74811991 169 I---LEGIEMIE 177
gi 74811992 175 V---REAIEIIK 183
gi 74811987 174 I---QEGIEMIE 182
gi 127082   179 V-------EQIR 183
gi 127083   176 I---RESLVVLR 184
gi 55977283 173 IdliREGLIVLR 184
gi 266533   174 V-------EQIR 178
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap