Conserved Protein Domain Family
Coatomer_E

?
pfam04733: Coatomer_E 
Click on image for an interactive view with Cn3D
Coatomer epsilon subunit
This family represents the epsilon subunit of the coatomer complex, which is involved in the regulation of intracellular protein trafficking between the endoplasmic reticulum and the Golgi complex.
Statistics
?
PSSM-Id: 252768
View PSSM: pfam04733
Aligned: 7 rows
Threshold Bit Score: 350.626
Threshold Setting Gi: 6647484
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam04733 is a member of the superfamily cl28726.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3MKR_A        1 DELFDVKNAFYIGSYQQCINeaqrVKPSSPERDVERDVFLYRAYLAQRKYGVVLDEIKPSS-APELQAVRMFAEYLASHS 79
gi 75029568  12 SVLFDARNEYYIGNFMGSINf---VLPEQGTAGPELLSYMYLSYLAIDSGRIVASDIKEGN-STPLQALRLVHEAFEQPS 87
gi 75336171   5 DHLFNLRNNFYLGAYQAAINss-dVANLSQEDTLERDTLVHRCYIALGQLQFVISEIHDDA-PTPLQAVKLLALYFSSPD 82
gi 75335958   5 DLLFNLRNLFYLGAYQAAINns-dVPGLDADAAAERDAIVFRSYIALGSYQLVISEIDSSA-ATSLQAVKLLALYLTG-- 80
gi 6647445    9 DHLFNLRNNFYLGAYQTAINns-eIANLSPENAVERDCLVFRSYIALGSYQLVISEIDESA-ATPLQAVKLLAMYLSTPQ 86
gi 6647484   10 NELYFVRQYFYSGNYTKLFei--dTTSMSEKGLELTEIYMARAKLALGESLESIQSI-LTQkTPGSAAILALAGEGNM-- 84
gi 6647444    3 DKLFSIRNYFFLGSYQSCIGealkFSSKNEEEKQEKDVYLYRSYIAQGQAFIPLKEIPAATkSADLAAVRRYAEFRNNPA 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3MKR_A       80 RRDAIVAELDREMSRSVDVTNtTFLLMAASIYFYDQNPDAALRTLHQG-DSLECMAMTVQILLKLDRLDLARKELKKMQD 158
gi 75029568  88 RTEELLEKLTDKVAGEEDETN-IWHLATAIVYCHDGQFENALKILHGS-TNLESMALSVQCLLRLQRVDLAKQLVAKMQE 165
gi 75336171  83 TKDSAIASLKEWLADPAIGNNaTLRLVAGLVFLHENDFNEALKHTNAG-GTMELHALNIQIFIKMHRSDYAERQLRIMQQ 161
gi 75335958  81 DKEGAISSLKEWLSDSAIGSNpVLRLIAGIVFMHEQDYNEALKHTHSG-GTLDLHALNVQIFIKMHRSDYAEKQLKIMQQ 159
gi 6647445   87 NKESTISSLKEWLADSTIGNNdTLRLIAGIIFMHEEDYNETLKHTHAG-GTMDLYALNVQIFIKMHRAEYAEKQLRVMQQ 165
gi 6647484   85 ----------ELIIDQHGNSDsVVQTLGAIFQIKNGSFDDAMDLLKKSvENLEAVALQVYIHLREHKIEAAEQTLKQALD 154
gi 6647444   83 AKKKILAEVQEEVASRNI-KSeIAAVLAATILNEADLSQDAFRAVSRF-EGLEARASKVFILIKMNKRKLAIGEVKKMNQ 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3MKR_A      159 QDEDATLTQLATAWVSLAAGG-EKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGVLQEALDKDSGHPETL 237
gi 75029568 166 ISDDATLTQLAQAWVALAQGT-EQMQDAFHIYQEFCEKFKPTPALLNGQAVVHLGLERYEEADSVLRESLLKKHNDYDTL 244
gi 75336171 162 IDEDHTLTQLANAWLNLAVGG-SKIQEAYLIFQDLSERYQSTSLLLNGKAVCCMHMGNFDEAETLLVEALNKDARDPETL 240
gi 75335958 160 IDEDHTLTQLANAWLGIAVGG-SKIREAYLIFQDFAEKYPMTGMVLNGKAVCCMHMGSFEEAETLLLEALNKDAKDPETL 238
gi 6647445  166 IDEDHTLTQLASAWLNLAVGG-SKIQEAYLIFEDFSEKYPMTCLILNGKAVCCMQMGNFDEAETLLLEALNKDAKDPETL 244
gi 6647484  155 WADEEIVLQLAQSWIKIVSGGvESYNDAFYVFEELNGT-DSNPMTLTGMACADICLLRPEEALSSLKTALDSQPNYEEAL 233
gi 6647444  161 IDEDATLSQLANALVTSFGAS-GKVKDALYIYSEMSDKYGRTTDLEMHQAVVSILTQDYAAAEELLESALERDNKDADVL 239
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|..
3MKR_A      238 INLVVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYRAKENDFDRLVLQYA 289
gi 75029568 245 INLMVHAHLTGKPTEAITRNLEQLRQFYPKSDFVTDLDKKSAEFDRLCLQYD 296
gi 75336171 241 ANLVVCCLHLGKP---SNKSFSQLKLSHPEHVLVKRVSSAEESFDRALQSFS 289
gi 75335958 239 ANLIVCNLHLGKP---SSRYLSQLKLSHPDHVLVKNAAASEATFERALQAVA 287
gi 6647445  245 ANLVVCSLHVGKS---SSRHLSQLKLSHPEHILVKRVSSAEDNFERAVQLVA 293
gi 6647484  234 SNMTTAITDLGPDAPSQAKNILSSFTNSSTLKLNDHLNEKAQEFDTFSTQFL 285
gi 6647444  240 INSIVSAQLNEKDDDVVERFISQLKHEHPNHPWVIDFNEKEAEFDRVASDSR 291
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap