2B0G


Conserved Protein Domain Family
RRM2_SNF

?
cd12479: RRM2_SNF 
Click on image for an interactive view with Cn3D
RNA recognition motif 2 (RRM2) found in Drosophila melanogaster sex determination protein SNF and similar proteins
This subgroup corresponds to the RRM2 of SNF (Sans fille), also termed U1 small nuclear ribonucleoprotein A (U1 snRNP A or U1-A or U1A), an RNA-binding protein found in the U1 and U2 snRNPs of Drosophila. It is essential in Drosophila sex determination and possesses a novel dual RNA binding specificity. SNF binds with high affinity to both Drosophila U1 snRNA stem-loop II (SLII) and U2 snRNA stem-loop IV (SLIV). It can also bind to poly(U) RNA tracts flanking the alternatively spliced Sex-lethal (Sxl) exon, as does Drosophila Sex-lethal protein (SXL). SNF contains two RNA recognition motifs (RRMs); it can self-associate through RRM1, and each RRM can recognize poly(U) RNA binding independently.
Statistics
?
PSSM-Id: 240923
View PSSM: cd12479
Aligned: 3 rows
Threshold Bit Score: 150.628
Threshold Setting Gi: 122919626
Created: 14-Sep-2011
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2B0G_A     4 EQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEALQGFKITPTHAMKITFAKK 83  fruit fly
EFX71329 148 EQPPNQILFLTNLPEETNEMMLSMLFTQFPGFKEVRLVPGRHDIAFVEFENEVQSAGARESLQGFKITPTHSMKISFAKK 227 common water flea
AEO36665 104 EQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENEIQSSAAKEALQGFKITPTHAMKITFAKK 183 Amblyomma maculatum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap