Conserved Protein Domain Family
PTZ00169

?
PTZ00169: PTZ00169 
ADP/ATP transporter on adenylate translocase; Provisional
Statistics
?
PSSM-Id: 240302
View PSSM: PTZ00169
Aligned: 11 rows
Threshold Bit Score: 527.029
Threshold Setting Gi: 67582454
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71030136    1 MEVNKNFLVDFLMGGVSAAISKTAVAPIERVKMLIQTQDSIPDIKSGKVPRYSGILNCFARVSKEQGVTSLWRGNLANVI 80 
124802973   3 SDIKTNFAADFLMGGISAAISKTVVAPIERVKMLIQTQDSIPEIKSGQVERYSGLINCFKRVSKEQGVLSLWRGNVANVI 82 
84995696    1 MEVNKNFLVDFLMGGVSAAISKTAVAPIERVKMLIQTQDSIPDIKSGKVPRYSGILNCFARVSKEQGVTSLWRGNLANVI 80 
156089447   1 MENKTSFVTDFLMGGVSAAVSKTAVAPIERVKMLIQTQDTIPEIKSGKLPRYTGIVNCFGRVCAEQGVSSLWRGNMANVI 80 
156091536   3 GDFKTNFAADFLMGGVSAAISKTVVAPIERVKMLIQTQDSIPEIKSGQVERYSGLINCFKRVSQEQGVMSLWRGNTANII 82 
156081823   3 GDFKTNFAADFLMGGVSAAISKTVVAPIERVKMLIQTQDSIPEIKSGQVERYSGLINCFKRVSQEQGVMSLWRGNTANII 82 
209876830  14 CSKFNSFALDFTTGGISAALSKTAVAPIERVKLLLQTQDTNPNIISGNTLRYKGIVDCITRVTKEQGYISLWRGNLTNVI 93 
66359700   26 KKKKNNFLTDFIVGGISATISKTAVAPIERVKLLLQTQDTNPDIIKGLIPRYAGIFDCLRRVSKEQGILSLWRGNTTNVI 105
237836049  18 DSQLMNTAKDFLAGGISAGVSKTIVAPIERVKMLIQTQDSIPEIKEGKIPRYTGIVDCFRRVSAEQGVASLWRGNMANVI 97 
221054285   3 GDFKTNFAADFLMGGVSAAISKTVVAPIERVKMLIQTQDSIPEIKSGQVERYSGLINCFKRVSQEQGVMSFWRGNTANII 82 
67582454   11 KKKKNNFLTDFVVGGISATISKTAVAPIERVKLLLQTQDTNPDIIKGLIPRYAGIFDCLRRVSKEQGILSLWRGNTTNVI 90 
71030136   81 RYFPTQAFNFAFKDYFKRMFPKYNQKTDFWKFFGANLASGGLAGASSLLIVYPLDFARTRLASDVGKGAKREFTGLLDCL 160
124802973  83 RYFPTQAFNFAFKDYFKNIFPRYDQNTDFSKFFCVNILSGATAGAISLLIVYPLDFARTRLASDIGKGKDRQFTGLFDCL 162
84995696   81 RYFPTQAFNFAFKDYFKRMFPKYNQKTDFWKFFGANLASGGLAGASSLLIVYPLDFARTRLASDVGKGAKREFTGLLDCL 160
156089447  81 RYFPTQAFNFAFKDFFKTLFPKYNQKTEFWKFFAANVASGGLAGASSLMIVYPLDFARTRLASDVRKEGQREFTGLLDCL 160
156091536  83 RYFPTQAFNFAFKDYFKNVFPKYDQNTDFTKFFCVNILSGATAGAISLLIVYPLDFARTRLASDIGKGKDRQFTGLFDCL 162
156081823  83 RYFPTQAFNFAFKDYFKNVFPKYDQNTDFTKFFCVNILSGATAGAISLLIVYPLDFARTRLASDIGKGKDRQFTGLFDCL 162
209876830  94 RYFPTQAFNFAFKDTFKSLFPKYEKDIEFWKFFGANIASGGLAGATSLGIVYPLDFARTRLAADIGKKSQREFKGLIDCL 173
66359700  106 RYFPTQAFGFAFKDMIRDMMPRYNKESDFWKFFGVNMLSGGLAGAASSGIVYPLDFARTRLATDIGKNGSKEFKGMFDCI 185
237836049  98 RYFPTQAFNFAFKDTFKRMFPRYDQKKEFWKFFCTNVASGGLAGASSLVIVYPLDFARTRLASDVGKGNEREFTGLVDCL 177
221054285  83 RYFPTQAFNFAFKDYFKNVFPKYDKNADFTKFFCVNILSGATAGAISLLIVYPLDFARTRLASDIGKGKDRQFTGLFDCL 162
67582454   91 RYFPTQAFGFAFKDMIRDMMPRYNKESDFWKFFGVNMLSGGLAGAASSGIVYPLDFARTRLATDIGKNGSKEFKGMFDCI 170
71030136  161 MKIQRSTGVMSLYKGFMVSVQGIIVYRGAYFGMYDSAKTIFFGeNEKNANILFKWSIAQSVTIMAGLASYPLDTVRRRMM 240
124802973 163 AKIYKQTGLLSLYSGFGVSVTGIIVYRGSYFGLYDSAKALLFT-NDKNTNIVLKWAVAQSVTILAGLISYPFDTVRRRMM 241
84995696  161 LKIQRSTGVLSLYKGFLVSVQGIVVYRGAYFGMYDSAKTVFFGeNEKNANIFFKWSIAQSVTIMAGLASYPLDTVRRRMM 240
156089447 161 MKIKRSTGFMSLYKGFSISVTGIIVYRGTYFGMYDSAKAVLYG-DDKNVSLFFKWFVAQTVTINAGLASYPFDTVRRRMM 239
156091536 163 KKIYKQTGFLSLYSGFGVSVTGIIVYRGSYFGLYDSAKALLFN-NDKNTNIVLKWAVAQSVTILAGLISYPFDTVRRRMM 241
156081823 163 KKIYKQTGFLSLYSGFGVSVTGIIVYRGSYFGLYDSAKALLFN-NDKNTNIVLKWAVAQSVTILAGLISYPFDTVRRRMM 241
209876830 174 GKVSKQSGVASLYRGFVVSVQGIIVYRGAYFGLYDTAKALLFK-DNDGTNMLYKWFVAQTVTTTAGIISYPFDTVRRRMM 252
66359700  186 MKISKQSGIRSLYQGFFVSIQGIFVYRAAYFGLYDTTKEMFFK-NQKQENMLYKWIIAQTVTTSAGIICYPFDTIRRRMM 264
237836049 178 GKIFRRTGFFSLYQGFGVSVQGIIVYRGAYFGLFDTAKAMLFG-PNNDANLFYKWAVAQTVTAAAGVASYPFDTVRRRMM 256
221054285 163 TKIYKQTGLLSLYSGFGVSVTGIIVYRGSYFGLYDSAKALLFN-NDKNTNIILKWAVAQSVTILAGLISYPFDTVRRRMM 241
67582454  171 MKISRQSGIRSLYQGFFVSIQGIFVYRAAYFGLYDTTKEMFFK-NQKQENMLYKWIIAQTVTTSAGIICYPFDTIRRRMM 249
71030136  241 MMSGK-KATSEIMYANSFDCFVKMMKHEGLGGFYKGAFANILRGMGGALVLVFYDELQKLL 300
124802973 242 MMSGR-KGKEEIQYKNTIDCWIKILRNEGFKGFFKGAWANVIRGAGGALVLVFYDELQKLI 301
84995696  241 MMSGK-KATSEIMYANSLDCFVKMMKHEGLGGFYKGAFANILRGMGGALVLVFYDELQKLL 300
156089447 240 MMSGK-KQTSEIMYTSSLDCFRKILKNEGVNGFFKGAFANILRGFGGALVLVLYDELKKFV 299
156091536 242 MMSGR-KAKEEIQYKNTIDCWIKILKNEGLAGFFKGAWANVIRGAGGALVLVFYDELQKLI 301
156081823 242 MMSGR-KAKEEIQYKNTIDCWIKILKNEGLAGFFKGAWANVIRGAGGALVLVFYDELQKLI 301
209876830 253 MMAG--KKSSETLYTGTFDCFQKILATEGPSAFFKGTFSNIIRGTGGALVLVLYDEIKKAL 311
66359700  265 MMAG--KKGKDVLYTGAYDCLKKIIRKEGVGALFKGSLSNVLRGTGGALVLILYDEIKKAL 323
237836049 257 MMAGRkKGEQEIQYTGTADCWKKVYQQEGFKGFFKGAWANVLRGAGGALVLVFYDELKKML 317
221054285 242 MMSGR-KAKEEIQYKSTLDCWYKIIKNEGFAGFFKGAWANVIRGAGGALVLVFYDELQKLM 301
67582454  250 MMAG--KKGKDVLYTGAYDCLKRLLEKKELEHYLKVHYQMY-------------------- 288
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap