Conserved Protein Domain Family
PTZ00144

?
PTZ00144: PTZ00144 
dihydrolipoamide succinyltransferase; Provisional
Statistics
?
PSSM-Id: 240289
View PSSM: PTZ00144
Aligned: 19 rows
Threshold Bit Score: 595.124
Threshold Setting Gi: 290998938
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

PTZ00144 is classified as a model that may span more than one domain.
PTZ00144 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146163782 101 PLVQLTKTMPKYSLVTVNAKNSMKIKQFQSQ-YLLTHTSKANFAIKTINVPSMGDSITEGQVHQMLKKVGDYVELDEVVC 179
gi 71032295   29 SVLPTCKSAFTDPSTRYTNCFVLSKSSDFNP-LKLIGNRYFSKDLKVINVPTLGDSISEGTLTKWAVSVGDYLNVDDLIA 107
gi 84999488   29 SVLPTCKSTLTEPSDRYAKSFVSSKGSDFNP-LKLIGNRYFSKDIKVINVPTLGDSISEGTLTKWAVSVGDYLNVDDLIA 107
gi 124513182   1 MTKNLVFRLNKSLLHHVKSFNRTFLNHKYNSnANIEGSLKRYFSIETIKVPRLGDSITEGTINEWKKKVGDYVKADETIT 80
gi 156102881   1 MTQNLVLRLNKPLFYNAKGISRILNLECKQC-VNCHSTFKRCFSIDTIKVPRLGDSITEGTISEWKKKVGDYVKVDETIT 79
gi 156086008  17 PGPLASYRLLSKIPGGCGVLDRHFNG------FRSLHVSSTLLEVKTMKLPSLGDSISEGTLSEWKKNVGESVEVDEPIA 90
gi 221061065   1 MTQNLVLRLNKPLFYNAKGISRILNLECKQS-VKCHSKFKRCFSIETIKVPRLGDSITEGTISEWKKKVGDYVKMDETIT 79
gi 290998938   1 ----------------------------------------------MIKVPSMGDSISSGEINEWVKKPGQACVEDEVIC 34
gi 145535011   1 ------------------MRQFAVSLFKVSQ-TQFAQIPKFYFSKKVVNVPTMGDSITEGDVKELQKKVGDYVNQDDVIA 61
gi 209882435  16 KIINRPYCGESTVTIFNTGLYNRVKYYRYLY-GTKKLFSNLTNDKIIVKVPQMGDSITEGTLNRWSKKLGEQVQKDDVVG 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146163782 180 SVETDKTQVPIRSPEAGVITELFAQEGENVNVGKPFFVLDTDGKK-PEGAAKPAAAAAGAKKEE----APKKAEAAKPAA 254
gi 71032295  108 VVETDKVSVDVNSPFSGVLTKTFSNTGDTILVGKPLVEIDLAGKPsDKPPEKKTEDKPPTPAPS----KPEPKSPEPPKP 183
gi 84999488  108 VVETDKVSVDVNSPFSGVLTKTFSNTGDTILVGKPLVEIDLAGKPsEKAPEKKPDAKPPASTPT----KPETKSPEPPKP 183
gi 124513182  81 IIDTDKVSVDINSKVSGGLSKIFADVGDVVLVDAPLCEIDTSVEPpEDICKTKEEVGESKNNENnytfNQLNRDIKDEAH 160
gi 156102881  80 IIDTDKVSVDINSKSSGALSKIFAEAGDIVLVDAPLCEIDTSVEPpAHISEVKEEIAQSKTVQA----SEQNGSEKEEGK 155
gi 156086008  91 IVETDKVTVDINSTLSGVIVKQHYEVDDTVLVGKPFIDVDAGG-------------------------SAAAPAETASGV 145
gi 221061065  80 IIDTDKVSVDINSQFSGELSNIFAEAGEIVLVDAPLCEIDTSVEApAHITEVKKGITQSKSEKE----SEETGKEEESGE 155
gi 290998938  35 TIDTDKVSVEIRAPEAGVLKAILANAKDTVEVGKDIAIIDTDGKPtATPAAAASTPSTTTTTT-----TTASTPSTPTPT 109
gi 145535011  62 LIETDKVTIDIRCADSGLITQMFAADGAKVEVGKPFYEIDTTAAKpAGAAATPETKKEEKKEQK----QEVKQEQKQEAP 137
gi 209882435  95 IIDTDKISVDILAPNTGKITQFLANPGDIVPVGASILEISLNDIEpVEKVSNPDNIKDESTNKEeiidKKDDIFITKEEI 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146163782 255 STPAPEAAKKTEAPKAASSSAASQKPTQMAipaglfqnkskkkqivnqfsqnkqsnqkassnqvskqanissqwgekNRT 334
gi 71032295  184 SDSKPVSSSQVKPPTPVQSKPLPPLEKASSlsmvppt----------------------------------qvpssdLEP 229
gi 84999488  184 ADSKPVSSFEVKTPPTPVESKPLPQFEKGSplsmvpp---------------------------------tpvpssdLEP 230
gi 124513182 161 IKDEVSKNEKDIFVKDPICFGNDYESINER-------------------------------------------------T 191
gi 156102881 156 KDQNSAHKESERKVSEANNTRVLYEAVSER-------------------------------------------------T 186
gi 156086008 146 DSKSPEPVAEVKADEPAPTETRVCYQLSLH-------------------------------------------------- 175
gi 221061065 156 KEHNVAHKESERRVSEENNGKMIYEPVSER-------------------------------------------------T 186
gi 290998938 110 ATPTPTPKKEEAKPTQSSAPTTSANGLART-------------------------------------------------- 139
gi 145535011 138 AAQKSTPPPAAKPAEKKPVAPSVTTPTQRT-------------------------------------------------- 167
gi 209882435 175 EHKTETDSALGPTETVSQYSSDYLNNIDIDik-------------------------------------------ehNRS 211
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146163782 335 ETRQPLSKMRQRIGQRLKDSQNTYALLPTFNEVDMSNVMEIRNKYQEQFQKk-hNVKLGFMSFFVKAATAALQQQPIVNA 413
gi 71032295  230 ETRVPLTRMRMRIAERLKHAQTENVMLTTFNECDMSELTKVRKMLNESGEV---SCKLGFVSAFMRASTLALLKMPIMNS 306
gi 84999488  231 ETRVPLTRMRMRIAERLKLAQTENVMLTTFNECDMSELTKVRKMLNE--SGe-vSCKLGFVSAFMRASTLALLKMPIMNS 307
gi 124513182 192 ERRVRMLPIRKRIAERLKESQNTCALLTTFNECDMSKAMLLRSELNDIFQKk-ySCKLGFVSLFMYASTLALKKMPNVNA 270
gi 156102881 187 ETRVRMLPIRKRIAERLKESQNTCALLTTFNECDMSKVIVLRSELKDIFQKk-yGCKLGFVSLFMHASTLALKKMPQVNA 265
gi 156086008 176 NVQVQMTRMRKRIGERLKESQQTTVMLSTFNECDMDAIMALRKELNE--SGk-yPVKLGYVSAYMKASTMALLKMPIMNS 252
gi 221061065 187 ETRVRMLPIRKRIAERLKESQNTCALLTTFNECDMSKVIVLRSELKDIFQKk-yGCKLGFVSLFMHASTLALKKMPQVNA 265
gi 290998938 140 ERRVKMTRIRAKIAERLKQAQNTYAMLTTFNEIDMKKIMELRKVNQDDFQErhdGLKLGFMGAFCKAASIALTEVPAVNG 219
gi 145535011 168 EKREPMSRMRQRIAQRLKDAQNTYALLTTFQECDMSAVMEAREAMQKDFQKk-hNVKLGFSSFFIKAAVKQLQEQPIVNA 246
gi 209882435 212 ETRQPMSRMRQRIAERLKGAQNMMAMLTTFTECDMSNLLDLKSKYSTEFTKi-hGIKFGMMSTFVKACTVSLKKMPEVNT 290
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146163782 414 VIDGKE-------IVYRNYVDISVAVATPTGLMVPVLRNTENMSFADVEREIIRLGNKGKEGSITVEDMVGGTFTISNGG 486
gi 71032295  307 YIEGNE-------MVTKNYVDISVAVATPTGLLVPVIRNCEFKNWEELELSLLEMAKKAREGSITIEDMTGGTFTISNGG 379
gi 84999488  308 YIDGKE-------MVTKNYVDISVAVATPTGLLVPVIRNCEFKNWEELELSLLEMAKKARDGSITIEDMTGGTFTISNGG 380
gi 124513182 271 YIENDE-------IVYKNYIDISVAVATPNGLTVPVIRNCQNKNLPQLELALSDLATKARSNKLSIDDFSGGTFTISNGG 343
gi 156102881 266 YIDNDE-------IVYRNYVDISVAVATPNGLTVPIIRDCQNKKLSELELALSELATKARNNKLSLDDFTGGTFTISNGG 338
gi 156086008 253 YIEGDD-------IVTKHFVDISVAVATPTGLVVPVIRNCEGKSWIELEQQLVDAAAKGREGRLTVADMTGGTFTISNGG 325
gi 221061065 266 YIDKDE-------IVYRNYIDISVAVATPNGLTVPIIRDCQNKKLSELELALSELATKARNNKLSLDDFTGGTFTISNGG 338
gi 290998938 220 VIDGNE-------VVYRDYVDISVAVATPNGLVVPVVRNCESKSIAQIERDISNLGEKARKNAISLDDMQGGTFTISNGG 292
gi 145535011 247 VIDGTD-------IVYRNYIDISMAVATPTGLMVPVLRNCERLSFADIEKTLIDLAEKGRQGKISADDMVGGTFTISNGG 319
gi 209882435 291 YIIEDPgerkgiiLSTRNYVDISVAVATPNGLVVPVIRDCDKKEIWEIEKELAMMAEKARKGNITLEDMSGGSMTITNGG 370
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146163782 487 TYGSLFGMPILNPPQSAILGMHAVQNRPVVRGD------QIVARPMMYLALTYDHRLIDGREAVTFLKTIKEIVEEPSKL 560
gi 71032295  380 VYGSLLSTPIINPPQSSILGMHAITKRPVVRDD------NIVIRPVMNVALTYDHRLIDGRDAVTFLNTIKKFIENPSLL 453
gi 84999488  381 VYGSLLSTPIINPPQSSILGMHAITKRAVVRDD------NIVIRPVMNVALTYDHRLIDGRDAVTFLNTIKKFIENPSLL 454
gi 124513182 344 VFGSMLSTPIINMPQSAILGMHTIKNRPVVVNN------EIVIRPIMYLALTYDHRLLDGREAVQFLCAIRDYIENPNLM 417
gi 156102881 339 VFGSMLSTPIVNMPQSAILGMHTIKDRAVVVNN------EIVIRPIMYLALTYDHRLLDGRDAVQFLSAIKDYIENPSLM 412
gi 156086008 326 VYGSVLSTPIINPPQSSILGMHSIIKRCVVRDD------QMVIRPIMNLALSYDHRLIDGREAVQFLIAIKEAIENPKVL 399
gi 221061065 339 VFGSMLSTPIVNMPQSAILGMHTIKDRAVVVNN------EIVIRPIMYLALTYDHRLLDGRDAVQFLSAIKDYIENPNLM 412
gi 290998938 293 VFGSLMGTPIINPPQSAILGMHATKNRPIAIGD------QVVVRPMMYVALTYDHRIIDGREAVTFLKRVKELIEDPEKM 366
gi 145535011 320 VFGSLMGTPIINAPQSAILGMHAIVNRPVVRND------QIVARPMMYLALTYDHRILDGKDAATFLKKLATSIEDPRRI 393
gi 209882435 371 VFGSLFSTPIINPPQSCILGMHSISDKPVACTNptsgekEVVIKPIMYLALTYDHRLIDGREAVLFLKNIKQCIENPEVL 450

                 ...
gi 146163782 561 LFE 563
gi 71032295  454 LLK 456
gi 84999488  455 LLK 457
gi 124513182 418 LID 420
gi 156102881 413 LID 415
gi 156086008 400 LEN 402
gi 221061065 413 LID 415
gi 290998938 367 LLF 369
gi 145535011 394 LLD 396
gi 209882435 451 LLG 453
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap