Conserved Protein Domain Family
PTZ00024

?
PTZ00024: PTZ00024 
cyclin-dependent protein kinase; Provisional
Statistics
?
PSSM-Id: 240233
View PSSM: PTZ00024
Aligned: 10 rows
Threshold Bit Score: 553.986
Threshold Setting Gi: 237832823
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
237832823  43 IKREGKQRYRQCDAFLGEGTYGRVEKAEDLRTHQIVAIKKVKASAGSLfasgdsgsvgsgektraqllrqNVGSVGLHFT 122
124802275   1 MENNSTERYIFKPNFLGEGSYGKVYKAYDTILKKEVAIKKMKLNKISN----------------------YIDDCGINFV 58 
156096843   1 METKSAERYIFKPNFLGEGSYGKVYKAYDTILKKEVAIKKMKINKISN----------------------YIDECGINFV 58 
126652097   1 -MFSISERYEQINAHIGQGTYGKVEKAIDKNSDTIVAIKKVKICELPSdlte---------------srqKVGQCGIHFT 64 
156087076  11 TSADISSRFKPLGKHLGEGTYGTVSLYLDTKTGRKVAIKKLKNIEWKGer-------------------qLVGMVGIHFT 71 
71033321   80 ESESLDKRFTPVGKHLGEGTYGQVIKAMDTLTGKMVAIKKVKNIEYKKgvtk---------------drqLVGMVGIHFT 144
84998548   76 GSDSLDKRFTPVGKHLGEGTYGQVIKAMDTLTGKMVAIKKVKNIEYKKgvtk---------------drqLVGMVGIHFT 140
209881265   1 ----MSKRYVQLNAHIGQGTYGKIEKARDTLDDSIVAIKKVKLTDIATdiks---------------srqKIGQCGIHFT 61 
221055293   2 METNSTERYIFKPNFLGEGSYGKVYKAYDTILKKEVAIKKMKINKISN----------------------YIDECGINFV 59 
67594819    1 -MFSISERYEQINAHIGQGTYGKVEKAIDKNSDTIVAIKKVKICELPSdlte---------------srqKVGQCGIHFT 64 
237832823 123 TVRELKVMREIEEENVMGVVDVFVEQDFICLVMELMHGDLKKLVDSKTRLAIQHVKCIMLQILRGLHALHKRYIVHRDLA 202
124802275  59 LLREIKIMKEIKHKNIMSALDLYCEKDYINLVMEIMDYDLSKIINRKIFLTDSQKKCILLQILNGLNVLHKYYFMHRDLS 138
156096843  59 LLREIKIMKEIKHQNIMTALDLYCEKDYINLVMEIMDYDLAKIINRKILLTDSQKKCILLQILNGLNVLHKYYFMHRDLS 138
126652097  65 VLREIKIMNEINHPNIMGLRDVFVQGDFINLVMDYMESDLRKVFENRIRFSESHIKCLLKQIILGINELHNWFIIHRDLA 144
156087076  72 ALRELKVMRELHHANLMDLVAVYVSQGFINIVMDLMAGDLKKVLDSNIRLSVSYQKCIMWQLLKGLEELHNCNFVHRDLS 151
71033321  145 TLRELKVMTELSHENLMGLVAVYVKESFINIVMDVMASDLKKVVDAKIRLTEPNVKCIMSQILTGLSVLHSSSFAHRDLS 224
84998548  141 TLRELKVMTELSHENLMGLVAVYVKEGFINIVMDIMASDLKKVVDAKVRLTEPNVKCIMSQILTGLSVLHASSFAHRDLS 220
209881265  62 VLRELKIMNEIHHPNTMELRDVFVQGEFINVVMDYMESDLRRVFEDRIRFSEAQIKCILRQIVQGVAELHKWYILHRDLA 141
221055293  60 LLREIKIMKEIKHQNIMTALDLYCEKDYINLVMEIMDYDLAKIINRKVLLTDSQKKCILLQILNGLNVLHKYYFMHRDLS 139
67594819   65 VLREIKIMNEINHPNIMGLRDVFVQGDFINLVMDYMESDLRKVFENRIRFSESHIKCLLKQIILGINELHNWFIIHRDLA 144
237832823 203 PANVFINDQGICKVADFGLSRCFGCPVVSGTLSKQEQskgetsqpgkessvesasktapvaiSRKELMTSKVVTLWYRPP 282
124802275 139 PANIFINKKGEVKLADFGLCTKYGYDMYSDKLFRDKY-------------------------KKNLNLTSKVVTLWYRAP 193
156096843 139 PANIFINKKGEVKIADFGLSSKYAFDMYVDSYAKDKHt------------------------KRTLNMTSKVVTLWYRAP 194
126652097 145 PANIFINSKGIAKVGDFGLARSYG--------------------------------------QPRREYTPEVVTLWYRCP 186
156087076 152 PANVFITDEGVMKIADFGLARRCVYSPLMPPTSKRINpsdl------------------dkyCLREKMTYRVVTLWYRSP 213
71033321  225 PANIFIDNFGVCKIADFGLARRTVNPPIFRECTDLETme---------------------lnASRERMTSKVVTLWYRAP 283
84998548  221 PANIFIDTFGVCKIADFGLARRTVNPPIFRDCSDLETme---------------------lnASRERMTSKVVTLWYRAP 279
209881265 142 PANIFINSKGIAKVGDFGLARSFG--------------------------------------QPRREYTPEVVTLWYRSP 183
221055293 140 PANIFINKKGEVKIADFGLSSKYAYDMYVDTYSKDKYn------------------------KRTLNLTSKVVTLWYRAP 195
67594819  145 PANIFINSKGIAKVGDFGLARSYG--------------------------------------QPRREYTPEVVTLWYRCP 186
237832823 283 ELLFGADRYGQAVDMWSVGCIMAELLT-GSPLFPGANEIDQLSRIFSLRGTPTTAAalldeepslWPLASSLPSFFPFTH 361
124802275 194 ELLLGSNKYNSSIDMWSFGCIFAELLL-QKALFPGENEIDQLGKIFFLLGTPNENN---------WPEALCLPLYTEFTK 263
156096843 195 ELLMGSNKYNSSVDMWSFGCIFAELLL-QKALFPGENEIDQLGKIFFLLGTPSEDN---------WPEALYLPLYTEFTK 264
126652097 187 ELLFGSTKYTHAVDMWSIGCIFAELLTgGKALLPGDDEVRQLGRIFELLGTPNEDN---------WPQAKELPLYCEFSP 257
156087076 214 ELLLGAEAYHFACDVWSVGCIFAELLN-QKPLFTGTNEIDQLGRIYKLLGTPSDTN---------WPDAKKLKLYTPFTA 283
71033321  284 ELLMGAECYHFACDLWSVGCIFAELLS-GKPLFPGTNEIDQLGKIYNILGTPEPT----------WPEVTKLPLYTQYSF 352
84998548  280 ELLMGAECYHFACDLWSVGCIFGELLS-GKPLFPGTNEIDQLGKIYNLLGTPENS----------WPQASKLPLYTQYSF 348
209881265 184 ELLLGATKYSDAVDMWSIGCIFAELLSgGKPLLPGEDELRQLGRIYELLGTPSDTN---------WPQSRNLPLYCEFTP 254
221055293 196 ELLMGSNKYNSSVDMWSFGCIFAELHL-QKALFPGENEIDQLGKIFFLLGTPNEDN---------WPEALYLPLYTEFTK 265
67594819  187 ELLFGSTKYTHAVDMWSIGCIFAELLTgGKALLPGDDEVRQLGHIFELLGTPNEDN---------WPQAKELPLYCEFSP 257
237832823 362 TKPKSLKSVLPFCCADSLDLLDKLLQLDPSKRITAAEALNHRWFQQNPKPCSPKDLPVHLL 422
124802275 264 ATKKDFKTYFKIDDDDCIDLLTSFLKLNAHERISAEDAMKHRYFFNDPLPCDISQLPFNDL 324
156096843 265 ANKKDFKSLFKIDDDDCIDLLMSFLRLNSHERITAEDALKHKYFFSDPLPCDASQLPFNEL 325
126652097 258 RSPLNFKDIFPNASEMAIDLIQSFLRLNPLERISASQALEHEYFKSYPLPCDPSELPLNYF 318
156087076 284 MQPTSLDTTIKNRSADEIDLLQRMLKLDPKERISVKEALKHKYFTTSPTMCKPNQLPFDFI 344
71033321  353 SKPKDLSTLFPHANSVTLDLLSQLLKLNPNERISAKKALEHEYFKVQPLKCKPKDLPFDFI 413
84998548  349 SKPKDLSLHFQHANSVTLDLLSKLLKLNPNERISAKEALDHEYFKVQPLKCKPIDLPFDFI 409
209881265 255 RMPQQLKDIFPNASDSAIDLLRSLLKLNPLERISAKDTLNHEYFNNFPLPCDPSELPLMYL 315
221055293 266 ANKKDFKNILKIDDDDCIDLLMSLLRLNSHERITAEEAMKHKYFFSDPLPCDVSQLPFNDL 326
67594819  258 RSPLNFKDIFPNASEMAIDLIQSLLRLNPLERISASQALEHEYFKSYPLPCDPSELPLNYF 318
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap