1ZFS,1K2H


Conserved Protein Domain Family
S-100A1

?
cd05025: S-100A1 
Click on image for an interactive view with Cn3D
S-100A1: S-100A1 domain found in proteins similar to S100A1. S100A1 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. As is the case with many other members of S100 protein family, S100A1 is implicated in intracellular and extracellular regulatory activities, including interaction with myosin-associated twitchin kinase, actin-capping protein CapZ, sinapsin I, and tubulin. Structural data suggests that S100A1 proteins exist within cells as antiparallel homodimers, while heterodimers with S100A4 and S100B also has been reported. Upon binding calcium S100A1 changes conformation to expose a hydrophobic cleft which is the interaction site of S100A1 with its more that 20 known target proteins.
Statistics
?
PSSM-Id: 240152
View PSSM: cd05025
Aligned: 5 rows
Threshold Bit Score: 155.046
Threshold Setting Gi: 68384208
Created: 2-Feb-2007
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:Ca2+ binding site [ion binding site]
Evidence:
  • Structure:1ZFS_A, rat S100a1 bound with calcium ions, contacts at 3.5 A
    View structure with Cn3D
  • Comment:the N-terminal EF hand is a S100 specific feature while the C-terminal canonical EF hand is similar to the EF hands in calmodulin, troponin C, and parvalbumin
  • Comment:the second binding site (C-terminal EF hand) has a greater affinity for Ca2+ than the first (N-terminal EF hand)

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                         #    ## ##   #                            ##   # ###  #       
1ZFS_A        1 GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAA 80
1K2H_B        1 GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAA 80
gi 56205585  55 GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAA 134
gi 47210402   2 TSKLQSAMENLILVFHTYSGKEGDKYKLSKHELKNLLRGELGDILPASRDQIMVDNIMRDLDENRDGEVDFQEFVVMVAG 81
gi 68384208   2 VSKLENAMEGLIKVFHTYSSKEGDKYKLSKSELKSLLQGELSDFLAASKDPMVVEKIMSDLDENRDGEVDFQEFVVLVAA 81
                        90
                ....*....|..
Feature 1                   
1ZFS_A       81 LTVACNNFFWEN 92
1K2H_B       81 LTVACNNFFWEN 92
gi 56205585 135 LTVACNNFFWEN 146
gi 47210402  82 LTVVCNEFFMDC 93
gi 68384208  82 LTVACNEFFVES 93

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap