Conserved Protein Domain Family
BAH_MTA

?
cd04709: BAH_MTA 
BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins. The Metastasis-associated protein MTA1 is part of the NURD (nucleosome remodeling and deacetylating) complex and plays a role in cellular transformation and metastasis. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
Statistics
?
PSSM-Id: 240060
Aligned: 14 rows
Threshold Bit Score: 194.147
Threshold Setting Gi: 47228791
Created: 18-Sep-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAH66458        3 ANMYRVGDYVFFENS--SSNPYLIRRIEELNKta------------------------------------------sgNV 38   zebrafish
2498589         3 ANMYRVGDYVYFENS--SSNPYLIRRIEELNKta------------------------------------------ngNV 38   human
CAG31669        3 ANMYRVGDYVYFENS--SSNPYLIRRIEELNKta------------------------------------------ngNV 38   chicken
AAH77518        3 ANMYRVGDYVYFENS--SSNPYLIRRIEELNKta------------------------------------------ngNV 38   African clawe...
AAW25419        4 NNMYRVGDFVYFEVA--AASPYHIRKIEELNKtp------------------------------------------tgAV 39   Schistosoma j...
BAA95898      102 DVVYRPGDCVYIVCRr-PNTPYFICSIQDFKLvhnsqaccrsptpalcdppacslpvasqppqhlseagrgpvgskrdHL 180  human
AAD34654       12 RVTYAVGDFVYFDDTsaTDAPYQIRKIEELVKte------------------------------------------kgGV 49   nematode
AAD27790       86 GTLYRLRDSVFVEVS--QNEPYVIAAICGFKYtk------------------------------------------rdHV 121  nematode
XP_001194554    3 ANMYRVGDYVYFETS--SSQPYLIRRIEELNKta------------------------------------------sgNV 38   purple urchin
XP_417594     102 DVVYRPGDCVYIESRr-PNTPYFICSIQDFKLvrnvftspppppfphpscsepl---tvsrtqhkgtagrgpagrkrdHL 177  chicken
2498589         3 ANMYRVGDYVYFENS--SSNPYLIRRIEELNKta------------------------------------------ngNV 38   human
CAG31669        3 ANMYRVGDYVYFENS--SSNPYLIRRIEELNKta------------------------------------------ngNV 38   chicken
AAH77518        3 ANMYRVGDYVYFENS--SSNPYLIRRIEELNKta------------------------------------------ngNV 38   African clawe...
AAW25419        4 NNMYRVGDFVYFEVA--AASPYHIRKIEELNKtp------------------------------------------tgAV 39   Schistosoma j...
BAA95898      102 DVVYRPGDCVYIVCRr-PNTPYFICSIQDFKLvhnsqaccrsptpalcdppacslpvasqppqhlseagrgpvgskrdHL 180  human
AAD34654       12 RVTYAVGDFVYFDDTsaTDAPYQIRKIEELVKte------------------------------------------kgGV 49   nematode
AAD27790       86 GTLYRLRDSVFVEVS--QNEPYVIAAICGFKYtk------------------------------------------rdHV 121  nematode
XP_001194554    3 ANMYRVGDYVYFETS--SSQPYLIRRIEELNKta------------------------------------------sgNV 38   purple urchin
XP_417594     102 DVVYRPGDCVYIESRr-PNTPYFICSIQDFKLvrnvftspppppfphpscsepl---tvsrtqhkgtagrgpagrkrdHL 177  chicken
AAH66458       39 EAKVVCFYRRRDISQsliqladkhakdleeeke----------------------------------------------- 71   zebrafish
2498589        39 EAKVVCFYRRRDISStlialadkhatlsvcykagpgadnge--------------------------------------- 79   human
CAG31669       39 EAKVVCFYRRRDISStlivladkharemeeeme----------------------------------------------- 71   chicken
AAH77518       39 EAKVVCLFRRRDISSslnsladsnarefede------------------------------------------------- 69   African clawe...
AAW25419       40 EAKVVCFYRRRDLSSnlvqladkhqkdlgt-------------------------------------------------- 69   Schistosoma j...
BAA95898      181 LMNVKWYYRQSEVPDsvyqhlvqdrhnend-------------------------------------------------- 210  human
AAD34654       50 DARCVVYLRRRDIPQhllkiadqaqrrfdnyyevdkkkpenfttkgfivvngaseaapeaapeateasaetsetkvkedt 129  nematode
AAD27790      122 VVKLTRYFRADDIPEislnlmkqerael---------------------------------------------------- 149  nematode
XP_001194554   39 EAKVVCFYRRRDIPNsliqladkhamaleeeq------------------------------------------------ 70   purple urchin
XP_417594     178 LMNVKWYYRQSEVPDsvyqhlvqdrhnend-------------------------------------------------- 207  chicken
2498589        39 EAKVVCFYRRRDISStlialadkhatlsvcykagpgadnge--------------------------------------- 79   human
CAG31669       39 EAKVVCFYRRRDISStlivladkharemeeeme----------------------------------------------- 71   chicken
AAH77518       39 EAKVVCLFRRRDISSslnsladsnarefede------------------------------------------------- 69   African clawe...
AAW25419       40 EAKVVCFYRRRDLSSnlvqladkhqkdlgt-------------------------------------------------- 69   Schistosoma j...
BAA95898      181 LMNVKWYYRQSEVPDsvyqhlvqdrhnend-------------------------------------------------- 210  human
AAD34654       50 DARCVVYLRRRDIPQhllkiadqaqrrfdnyyevdkkkpenfttkgfivvngaseaapeaapeateasaetsetkvkedt 129  nematode
AAD27790      122 VVKLTRYFRADDIPEislnlmkqerael---------------------------------------------------- 149  nematode
XP_001194554   39 EAKVVCFYRRRDIPNsliqladkhamaleeeq------------------------------------------------ 70   purple urchin
XP_417594     178 LMNVKWYYRQSEVPDsvyqhlvqdrhnend-------------------------------------------------- 207  chicken
AAH66458       72 -------------------------------------------------------------------------sppesdl 78   zebrafish
2498589        80 ----------------------------------------------------------------egeieeemenpemvdl 95   human
CAG31669       72 -------------------------------------------------------------------------npemvdl 78   chicken
AAH77518       70 --------------------------------------------------------------------------skqptv 75   African clawe...
AAW25419       70 ---------------------------------------------------------------------------cgdda 74   Schistosoma j...
BAA95898      211 ----------------------------------------------------------------------------sgre 214  human
AAD34654      130 ddvaekmeedeecpapvgqgrtssteepsasdapaatakdkkeekeakenaknlketaeaeatklidwgdgglplgvdkl 209  nematode
AAD27790      150 ------------------------------------------------------------------------------ei 151  nematode
XP_001194554   71 -------------------------------------------------------------------------eealeel 77   purple urchin
XP_417594     208 ----------------------------------------------------------------------------sgre 211  chicken
2498589        80 ----------------------------------------------------------------egeieeemenpemvdl 95   human
CAG31669       72 -------------------------------------------------------------------------npemvdl 78   chicken
AAH77518       70 --------------------------------------------------------------------------skqptv 75   African clawe...
AAW25419       70 ---------------------------------------------------------------------------cgdda 74   Schistosoma j...
BAA95898      211 ----------------------------------------------------------------------------sgre 214  human
AAD34654      130 ddvaekmeedeecpapvgqgrtssteepsasdapaatakdkkeekeakenaknlketaeaeatklidwgdgglplgvdkl 209  nematode
AAD27790      150 ------------------------------------------------------------------------------ei 151  nematode
XP_001194554   71 -------------------------------------------------------------------------eealeel 77   purple urchin
XP_417594     208 ----------------------------------------------------------------------------sgre 211  chicken
AAH66458       79 tekqkhqlrhRELFLSRQYESLPATHIRGKCSVALlnetevv---lsylekEDTFFYSLVYDPtqKTLLADKGEIRVGPR 155  zebrafish
2498589        96 peklkhqlrhRELFLSRQLESLPATHIRGKCSVTLlnetesl---ksylerEDFFFYSLVYDPqqKTLLADKGEIRVGNR 172  human
CAG31669       79 pekqkhqlrhRELFLSRQLESLPATHIRGKCSVTLlnetesl---ksylerEDFFFYSLVYDPqqKTLLADKGEIRVGNR 155  chicken
AAH77518       76 gdtnrhqlkhRELFLSRQFESLPATHIRGKCNVTLlnetdil---sqylekEDCFFYSLVFDPvqKTLLADQGEIRVGSK 152  African clawe...
AAW25419       75 qpdilhqihhRELFLSRHLETLPATHIRGKCTVTLhtetepy---hiylpkEDTFFFQLVYDPlqKTLQADQGSIREGPQ 151  Schistosoma j...
BAA95898      215 lvitdpviknRELFISDYVDTYHAAALRGKCNISHfsdifaa---refkarVDSFFYILGYNPetRRLNSTQGEIRVGPS 291  human
AAD34654      210 tpdqrlklrqHEIFMTRQSEILPAAAIRGKCRVVLlgdgeea---qnylplDDTFYHSLVYDPnaQTLLADKGAIRVGEK 286  nematode
AAD27790      152 nphlcpqslnRELFNSELQITQPVSCLRGKCIVEYvkdvrhartvadfsldNDTFFFCLHYNQdsTKLASTHYAIRVGTS 231  nematode
XP_001194554   78 nekqrhqlkhRELFLSRQLETLPATHIRGKCTVTLlnetesl---lsylskDDAFFYSLVYDPqqKTLLADKGEIRVGSR 154  purple urchin
XP_417594     212 lvitdpviknRELFISDYVDTYHAAALRGKCNISHfsdifaa---refkarVDSFFYILGYNPetRRLNSTQGEIRVGPS 288  chicken
2498589        96 peklkhqlrhRELFLSRQLESLPATHIRGKCSVTLlnetesl---ksylerEDFFFYSLVYDPqqKTLLADKGEIRVGNR 172  human
CAG31669       79 pekqkhqlrhRELFLSRQLESLPATHIRGKCSVTLlnetesl---ksylerEDFFFYSLVYDPqqKTLLADKGEIRVGNR 155  chicken
AAH77518       76 gdtnrhqlkhRELFLSRQFESLPATHIRGKCNVTLlnetdil---sqylekEDCFFYSLVFDPvqKTLLADQGEIRVGSK 152  African clawe...
AAW25419       75 qpdilhqihhRELFLSRHLETLPATHIRGKCTVTLhtetepy---hiylpkEDTFFFQLVYDPlqKTLQADQGSIREGPQ 151  Schistosoma j...
BAA95898      215 lvitdpviknRELFISDYVDTYHAAALRGKCNISHfsdifaa---refkarVDSFFYILGYNPetRRLNSTQGEIRVGPS 291  human
AAD34654      210 tpdqrlklrqHEIFMTRQSEILPAAAIRGKCRVVLlgdgeea---qnylplDDTFYHSLVYDPnaQTLLADKGAIRVGEK 286  nematode
AAD27790      152 nphlcpqslnRELFNSELQITQPVSCLRGKCIVEYvkdvrhartvadfsldNDTFFFCLHYNQdsTKLASTHYAIRVGTS 231  nematode
XP_001194554   78 nekqrhqlkhRELFLSRQLETLPATHIRGKCTVTLlnetesl---lsylskDDAFFYSLVYDPqqKTLLADKGEIRVGSR 154  purple urchin
XP_417594     212 lvitdpviknRELFISDYVDTYHAAALRGKCNISHfsdifaa---refkarVDSFFYILGYNPetRRLNSTQGEIRVGPS 288  chicken
AAH66458      156 FQADVPEMLQEGEADD 171  zebrafish
2498589       173 YQADITDLLKEGEEDG 188  human
CAG31669      156 YQADITDLLKEGEDDG 171  chicken
AAH77518      153 YQAEIPDQLAEGESDN 168  African clawed frog
AAW25419      152 YQADIEPYYPLTEDST 167  Schistosoma japonicum
BAA95898      292 HQAKLPDLQPFPSPDG 307  human
AAD34654      287 YQAVVDEWMEPADREA 302  nematode
AAD27790      232 FQATLPPMAECSVGDD 247  nematode
XP_001194554  155 YQADVTPLLKEEETDG 170  purple urchin
XP_417594     289 HQAKLPDLQPFPSPDG 304  chicken
2498589       173 YQADITDLLKEGEEDG 188  human
CAG31669      156 YQADITDLLKEGEDDG 171  chicken
AAH77518      153 YQAEIPDQLAEGESDN 168  African clawed frog
AAW25419      152 YQADIEPYYPLTEDST 167  Schistosoma japonicum
BAA95898      292 HQAKLPDLQPFPSPDG 307  human
AAD34654      287 YQAVVDEWMEPADREA 302  nematode
AAD27790      232 FQATLPPMAECSVGDD 247  nematode
XP_001194554  155 YQADVTPLLKEEETDG 170  purple urchin
XP_417594     289 HQAKLPDLQPFPSPDG 304  chicken
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap