1Z7Q


Conserved Protein Domain Family
proteasome_beta_type_5

?
cd03761: proteasome_beta_type_5 
Click on image for an interactive view with Cn3D
proteasome beta type-5 subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Statistics
?
PSSM-Id: 239730
View PSSM: cd03761
Aligned: 27 rows
Threshold Bit Score: 288.759
Threshold Setting Gi: 68400425
Created: 26-Apr-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
active sitebeta subunit
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1     #               # #             #                                               
1Z7Q_Z      1 TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKRVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAAS 80  baker's yeast
BAA96838   61 TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISIAGAS 140 Japanese rice
CAC08538  107 TTTLGFHFDGGIIIAVDSRASSGQYISSQTVMKVLEINEYLLGTMAGGAADCQYWERVLGMECRLWELRNNCRISVAAAS 186 Trypanosoma brucei
NP_113328  12 TTTLAFIFRGGIIVSVDSRASMGSYVGSSKVRKILEISNNLLGTMAGGAADCFFWERNLSSLCKIFEIRNNQKLSVAGSS 91  Guillardia theta
NP_189265  58 TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGAS 137 thale cress
NP_597314  32 TTTLAFIFKEGMVIAVDSRATSGSYIASQTVNKVININKNLLGTMAGGAADCLFWENLMGLYAKNYELTNGRRITVAAAS 111 Encephalitozoon cu...
NP_700585  61 TTTLAFKFKDGIIVAVDSRASMGSFISSQNVEKIIEINKNILGTMAGGAADCLYWEKYLGKIIKIYELRNNEKISVRAAS 140 Plasmodium falcipa...
CAD60862   78 TTTLGFIFQDGVIAAADTRASCKGLVCCPITHKIMPIHSHLVVNTSGSGADCMLWERILTREMRLYQLRHRTRLSINGAA 157 zebrafish
XP_653800  39 TTTLSMIIKEGIIVAVDSRATRGAFISSGSVQKYIPITSHIIGTMAGGAADCAYWERELTRQCRLFELRNKPPISVAAAS 118 Entamoeba histolyt...
XP_684166 110 TTTLGFAFQGGVIAAADTRSSCAGKVACPASPKVLPIHSHLVGTTSGTSADCALWKRILARELRLYQLRHRRRLSTGGAA 189 zebrafish
Feature 1                                                                                     
1Z7Q_Z     81 KILSNLVYQYKGAGLSMGTMICGYTrk----------------------------------------------------- 107 baker's yeast
BAA96838  141 KLLANILYSYRGMGLSIGTMIAGWDe------------------------------------------------------ 166 Japanese rice
CAC08538  187 KILANITYQYRNHGLSMGTMVAGWDq------------------------------------------------------ 212 Trypanosoma brucei
NP_113328  92 KVLMSMISNYKNAGLSMGTMILGWDk------------------------------------------------------ 117 Guillardia theta
NP_189265 138 KLLANMLYSYRGMGLSVGTMIAGWDe------------------------------------------------------ 163 thale cress
NP_597314 112 MYLSNCVYRYKGYGLSMGTMICGYDs------------------------------------------------------ 137 Encephalitozoon cu...
NP_700585 141 TILSNILYQYKGYGLCCGIILSGYDh------------------------------------------------------ 166 Plasmodium falcipa...
CAD60862  158 KLLSTMLHPFKGTNVCVAATLCGWDgeesqiqwktsmgtvnvnesmaqdstlsaisdesalgsekrasiseqeeilkdvp 237 zebrafish
XP_653800 119 KMLANILYQYRNYNLSVGSMICGYDk------------------------------------------------------ 144 Entamoeba histolyt...
XP_684166 190 KLLSHMLHPFKGTELCVAATLCGWDgdedqdnaqpmteryantt-----------------------------ltsksss 240 zebrafish
Feature 1                                       #                                    #  ##    
1Z7Q_Z    108 -----------eGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVN 176 baker's yeast
BAA96838  167 -----------kGPGLYYVDSEGARLMGSRFSVGSGSLYAYGILDEGYRYVMPVEEAAELARRAIYQATFRDGASGGCVS 235 Japanese rice
CAC08538  213 -----------fGPSLYYVDDKGTRVKHEIFSVGSGSIYAYGVLDQGYRKNLTVEEACDLARRSIFHATYRDGASGGIVT 281 Trypanosoma brucei
NP_113328 118 -----------nGPNIYYVDSEGSRIKIKIISVGSGCLFAYSILDSGYNWFTRINEAIDLGRNAIVQAALNDPYSGGYNN 186 Guillardia theta
NP_189265 164 -----------tGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVAS 232 thale cress
NP_597314 138 -----------sGPSIYYVDDDGKRVSGSLFSVGSGSTIAYGILSSSYRFDMDKDEALNLGRDAIFHAAHRDAFSGGLIN 206 Encephalitozoon cu...
NP_700585 167 -----------tGFNMFYVDDSGKKVEGNLFSCGSGSTYAYSILDSAYDYNLNLDQAVELARNAIYHATFRDGGSGGKVR 235 Plasmodium falcipa...
CAD60862  238 dqqnrstfggrfGPRVCYVCSDGLQLNGEIISVGSGSPYAYAVLDDGWRWGMTVDEAVGLAREAVFRATHWDAYSGNNVD 317 zebrafish
XP_653800 145 -----------tGPHIFYVEDGGVRIPGHLFSVGSGSPYAVSLIDSEYDYNMPKEKAIELARRAIFHATHRDVASGGNVN 213 Entamoeba histolyt...
XP_684166 241 qsaassglsgvrGPRVVYVCSDGLRLQGALFSVGSGSPYAYSILDGGVRWGMSAQEAAAVAREAVYRPTYRDAYSGNNVD 320 zebrafish
Feature 1                  
1Z7Q_Z    177 LYHVTEDGWIYHG 189 baker's yeast
BAA96838  236 VYHVGPNGWTKLS 248 Japanese rice
CAC08538  282 VYHVHPKGWTQIS 294 Trypanosoma brucei
NP_113328 187 LYLVRSNGWIKIF 199 Guillardia theta
NP_189265 233 VYHVGPQGWTKLS 245 thale cress
NP_597314 207 LYYMNEDGWTKVG 219 Encephalitozoon cuniculi GB-M1
NP_700585 236 VFHIHKNGYDKII 248 Plasmodium falciparum 3D7
CAD60862  318 LFYITARGWRRRE 330 zebrafish
XP_653800 214 VIFIDKDGWRLIS 226 Entamoeba histolytica HM-1:IMSS
XP_684166 321 LYHVTAKGWRRRE 333 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap