1IRU


Conserved Protein Domain Family
proteasome_beta_type_2

?
cd03758: proteasome_beta_type_2 
Click on image for an interactive view with Cn3D
proteasome beta type-2 subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis.Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Statistics
?
PSSM-Id: 239727
View PSSM: cd03758
Aligned: 27 rows
Threshold Bit Score: 224.772
Threshold Setting Gi: 12580728
Created: 26-Apr-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1IRU_Y      1 MEYLIGIQGPDYVLVASDRVAASNI-VQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNgy-elSPT 78  cattle
XP_651433   1 MDSCIGIVGKDFVLMAVDGNSGRGV-ITVRNDFNKIYPVQGNRLLTIIGEGNDRQVLADFVQRNIALNYYRNgl-ksTTQ 78  Entamoeba histolyt...
Q9NHC6      2 AETTIGFRCQDFVLVAAAGLNAFYY-IKITDTEDKITELDSHKVVACAGENGPRTHFVEYVKCNMALKKMREhgrmiSTH 80  Trypanosoma brucei...
NP_608698   1 METILGVKGTDFIILASDTMRNKSA-MWLDDEVRKTHRISDYCMMSTAGDGGDCLKFSDFILRNMDLYKITNgy-dlTVR 78  fruit fly
EAA40819    1 MDSVFGFKGKDFVCLVADTVFKHSI-LVLKECADRTVKIHEGQGMIVTGEDGDVLQFTDYIKHSLKLRSLRQgy-tpTVK 78  Giardia lamblia AT...
P91477      1 MHFLVGISTENYVILAADKATFAYGaILADSENDKEYRLGKKLTMMCIGEEGDVAQFGDWTKRNLQLYSVRNgy-evSPS 79  Caenorhabditis ele...
XP_765714   1 MDTLIGICGRDFVAVATDTYEKHSIvTLKNDDDSKIMQIDDSKLLLLAGPCCDRNQFGEYIRKSVHYHRYKTsf-dmTTK 79  Theileria parva st...
AAN37289    1 MDTLIGLRGNNFVVLAADTYSINSIiKLKNDDNTKFYDIHGNKCLLLGGSIGDRLQFGEFIRKNVHLYQYQNnt-dmFVK 79  Plasmodium falcipa...
AAY43418    1 MDSIFGIVGKDFVLLAADCKVVRSI-LVYKDDEDKSINLDEHKVMVTSGPQSDRLAFGEYIQKNMKLYELRNgv-tlNGP 78  potato late blight...
EAS01245    1 MDSAFGLVGKDFVIVATDCSVAYSI-LKLKDKEDKISLLDQNKVMALSGEQAYRLQFSDYIAKNIALNKYRNgt-efNTK 78  Tetrahymena thermo...
1IRU_Y     79 AAANFTRRNLADCLRsr-tpYHVNLLLAGYDeh-------------------eGPALYYMDYLAALAKAp-FAAHGYGAF 137 cattle
XP_651433  79 SIAHWIRRQVSDSLReg--gYQCSMLLGGVDe---------------------KPELFMIDQFGTLVPEt-YASHGIGSN 134 Entamoeba histolyt...
Q9NHC6     81 ATASFMRNTLAGALRsrdglYPVNCLLAGFDvpasae-----------ddvatGAHLYYLDYLGTLQEVp-YGCHGYGAP 148 Trypanosoma brucei...
NP_608698  79 GAVHFIRRHLSAYLKsd-ctFQVSLLVGGYDlt-------------------sGPELHYIDYLGNSVPVr-YGGHGAAMN 137 fruit fly
EAA40819   79 SSANFIRTELARAIReg--pYNVYVITGGVDa--------------------aGPQLYYMDYLGTMGEDn-FCVQGYSMY 135 Giardia lamblia AT...
P91477     80 CAHHFVRRSIAEGLRsq-dhYTVDVLIGGYDdk------------------edKAFLGSVDYLANGLGQqpYLFRGFCGR 140 Caenorhabditis ele...
XP_765714  80 SMAHFVRQQLAEYLRks--pYQVDLLVAGFDn--------------------nGPKLYWIDYLASSTEVd-RAVHGYGGH 136 Theileria parva st...
AAN37289   80 SFAFFTRKNLAYYLRrn--pFEVNCLIAGYDkvkkkkkliniyiyiyiciykdGYQLYWCDYLSNMDSVn-KGAHGYGAY 156 Plasmodium falcipa...
AAY43418   79 ATANYVRGELARFLRra--pYQVNLLIGAVDaspe---------------qkaEPSLHWIDYLGSMVKVn-FGAHGYGAH 140 potato late blight...
EAS01245   79 ECAEFVRSELAYGIRng--pFMVNCLIAGFDn--------------------nQPQLYWVDYMGTLVKSv-KAAHGYAAH 135 Tetrahymena thermo...
1IRU_Y    138 LTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDN 193 cattle
XP_651433 135 FVYALLDKNWHSGMEFEEALELMKKCIKEIQKRVIVSSSHYCIEVCYKDKTELIQG 190 Entamoeba histolytica HM-1:IMSS
Q9NHC6    149 FVTAMLDRMWRPNLTAQEGVELMQKCCDEVNKRVVVSNNTFICKAVPKDGVERVQS 204 Trypanosoma brucei brucei
NP_608698 138 FCTPILEEFYKPDMDTQAAYDVIKKCVIELYKRFVINLRNIDLFLISKNGITKMNS 193 fruit fly
EAA40819  136 FLLSVMSEYWKPDMTKQDALDLIKHCIDALGRRFLLQPTKFTASFIYQSLTEKEFI 191 Giardia lamblia ATCC 50803
P91477    141 FCYAIMDREYKKDMTEAEGLALMNKCIGEAKRRFVANIPGYKVVIIDKKGYRKLDD 196 Caenorhabditis elegans
XP_765714 137 FLRGLLDKEYHENLTVEEAVSLLKKCRHEVKNRFLLAQSNFRAKVIDKNGIHDVDI 192 Theileria parva strain Muguga
AAN37289  157 LVSAILDKYYHENLTVDEALDIFKLCFEELKKRFLLTQINYELRIMYDNKVETQYV 212 Plasmodium falciparum 3D7
AAY43418  141 FCLSIFDREWKPDMTLDEAKETLKKCRAELDMRFLVRNGQWAYTLIDAGGISQVKV 196 potato late blight agent
EAS01245  136 FVLSTLDHDYKPNLTLDEGIAIIKRCINELKTRFLISQSHFIAKIVTPAGIQVLEL 191 Tetrahymena thermophila SB210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap